Dataset for protein Bim of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A673IWZ7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L11 (length=182 residues).
MADSTILKQTLANGPASRGSGESAGGGAVLRSEHFDFPQPSDGDPLRGGIAMSNSHQSRSPMSRTFSRSSSGYFSVDSDS
VPSSPLMPNISEAQDGQNDEVWSAEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAAQLRAPNE
HAIIMWMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A673NIJ7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BCL2L11 (length=138 residues).
PLRGGISMSNSHQSRSPMCRTFSRSSSGYFSVDSDSVPSSPLMPNISEAQDGQNDEVWFAEPSHQHAQMAAPVGAMGPEM
AVARELRRIGDEFNRLYCQGAGAGGNNGAQLRAPNEHAIIMWMNDFIGRVVQFFLRRR
© 1998-2020Legal notice