Dataset for protein Bim of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673IWZ7_BCL2L11      MADSTILKQTLANGPASRGSGESAGGGAVLRSEHFDFPQPSDGDPLRGGI
A0A673NIJ7_BCL2L11      --------------------------------------------PLRGGI
                                                                    ******

A0A673IWZ7_BCL2L11      AMSNSHQSRSPMSRTFSRSSSGYFSVDSDSVPSSPLMPNISEAQDGQNDE
A0A673NIJ7_BCL2L11      SMSNSHQSRSPMCRTFSRSSSGYFSVDSDSVPSSPLMPNISEAQDGQNDE
                        :***********.*************************************

A0A673IWZ7_BCL2L11      VWSAEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGN
A0A673NIJ7_BCL2L11      VWFAEPSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGN
                        ** *******.***************************************

A0A673IWZ7_BCL2L11      NAAQLRAPNEHAIIMWMNDLIGRVVQFFLRRR
A0A673NIJ7_BCL2L11      NGAQLRAPNEHAIIMWMNDFIGRVVQFFLRRR
                        *.*****************:************

© 1998-2020Legal notice