Dataset for protein Bad of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mktyrsvgpmqlvsvlsisrrirscsaavsalaifhnlattvyahdallrtqrppererkrergkilelllpcsvsctvc
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                          :.. . :.*  : .:.  :.  
------------------------------------------------------mmaqmhsisdnsSttntskkgresti
elevncscaatphntgacqdssrnpnraseskhpdtqitrktvrrtptdsrnrl-dntlfghqyde ewedkedcedegq
                                                      i kr  d      dl         dl
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 .:.. . *   : ::  .*:.  . ..   :* .:*   : **  * :   **  *** **.***..** *****.***
vknnshsdQttpn-lsvqgRvrlyslsrvynvSrwqEdlpqtGAadEgnlvtGD--PFRpRSrSAPpaLWkAKKYGrQLR
ttqgqgqq rsqhdiappd lkgeqegqhrtl mnd avled  sa edggg  gl   g  q   av  a     q   
nnh    p kln                  m       e                                       
k         k                                                                     

       250       260       270       280       290
....:....|....:....|....:....|....:....|....:....|
*******  ****   ** *.: .*  .  .*::**** **.:. .    
RMSDEFDtwLDKG--rVKsAnttrQtyr--sWfsFLWShKEsegrs----
       il    mke  r gsqk mrqspg la    s  edaeerpae
                          q           p           
                                                  
© 1998-2020Legal notice