Dataset for protein Bad of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A673J9C6_BAD-01      MKTYRSVGPMQLVSVLSISRRIRSCSAAVSALAIFHNLATTVYAHDALLR
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
                                                                         

A0A673J9C6_BAD-01      TQRPPERERKRERGKILELLLPCSVSCTVCELEVNCSCAATPHNTGACQD
A0A673HRQ3_BAD-01      --------------------------------------------------
A0A673I6H5_BAD-01      --------------------------------------------------
A0A673J5Q9_BAD-01      --------------------------------------------------
                                                                         

A0A673J9C6_BAD-01      SSRNPNRASESKHPDTQITRKTVRRTPTDSRNRLIMAQMFSISDNESDTE
A0A673HRQ3_BAD-01      -----------------------------------MAQMFSISDNESETE
A0A673I6H5_BAD-01      ----------------------------------MDKRLHGHQYDSSTLN
A0A673J5Q9_BAD-01      ----------------------------------MDNTLHDHQDDSSTWN
                                                             :.. . :.*  :

A0A673J9C6_BAD-01      TSEDCEDSDLTKNNSGSQQKTNHDLAVPDRLKGEQLGRHRNLSMNDEDLL
A0A673HRQ3_BAD-01      TSEDCEESGQVKNNSGSPQRKQH-LAVPDRLKGEQLGRHRNLSMNDEDLL
A0A673I6H5_BAD-01      DKKKGREETINTHGQHQDQTSPN-ISPQGRVRLYSESQVYMVSRWQEAVP
A0A673J5Q9_BAD-01      DKKKGREETIKNQGQHQDQTLPN-ISPQGRVRLYSESQVYTVSRWQEAEP
                        .:.  :.   .:.. . *   : ::  .*:.  . ..   :* .:*   

A0A673J9C6_BAD-01      ETGAADEGDLVGGD--PFRPRSRSAPPALWAAKKYGRQLRRMSDEFDILL
A0A673HRQ3_BAD-01      ETGAADEGDLVGGD--PFRPRSRSAPPALWAAKKYGQQLRRMSDEFDILL
A0A673I6H5_BAD-01      QDGASAEENGGTGDGLPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWL
A0A673J5Q9_BAD-01      QDGALAEENGGTGDGLPFRGRSQSAPAVLWKAKKYGRQLRRMSDEFDTWL
                       : **  * :   **  *** **.***..** *****.**********  *

A0A673J9C6_BAD-01      DKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
A0A673HRQ3_BAD-01      DKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
A0A673I6H5_BAD-01      DKG--EVKRANSQKQTYR--GWFSFLWSSKEEEGRE----
A0A673J5Q9_BAD-01      DKG--EVKRANSQKQTYR--GWFSFLWSPKEEEGRE----
                       ***   ** *.: .*  .  .*::**** **.:. .    

© 1998-2020Legal notice