Dataset for protein Bad of organism Sinocyclocheilus rhinocerous

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A673HRQ3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BAD (length=152 residues).
MAQMFSISDNESETETSEDCEESGQVKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDPF
RPRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A673I6H5_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BAD (length=147 residues).
MDKRLHGHQYDSSTLNDKKKGREETINTHGQHQDQTSPNISPQGRVRLYSESQVYMVSRWQEAVPQDGASAEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSSKEEEGRE
>gnl|bcl2dbpro|A0A673J5Q9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BAD (length=147 residues).
MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDGALAEENGGTGDG
LPFRGRSQSAPAVLWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|A0A673J9C6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus rhinocerous GN=BAD (length=288 residues).
MKTYRSVGPMQLVSVLSISRRIRSCSAAVSALAIFHNLATTVYAHDALLRTQRPPERERKRERGKILELLLPCSVSCTVC
ELEVNCSCAATPHNTGACQDSSRNPNRASESKHPDTQITRKTVRRTPTDSRNRLIMAQMFSISDNESDTETSEDCEDSDL
TKNNSGSQQKTNHDLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDPFRPRSRSAPPALWAAKKYGRQLRRM
SDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
© 1998-2020Legal notice