Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus grahami

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         :                                                                      
-------sddesdtetsedce-s--tknrsqtpqrts-------------------------------------------
maqmfsimsn-----------wpstrvsnegsqgqgnevgqtanrhgesaggaavlgsghfdfpqpsdgdplrglegdas
 dntlhmhe ddsvrrkglqhr-esi-qiknhetk l          rfedrstqta svlnsvrng ma fq       
  kr  ddr  eeewndrkkgdedlvstsg rdda i                                           
        q     qlpkc  t lrnn q       q                                           
              l  h   e gq           g                                           

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                     .                           .         .    
-----------------------------pslspsgrlkgeslsrprnpsmndedlletgaa--degdlvggdpfrprsr
spcravdartafgiamssshqsrspmsrthpravpdyfsvyqhgvhyslly--pnisqlqppve-svwtpepvvqhqqmq
             vncgtgglaslt cpgfnicsqamvrlrvevqvsrvarwqtgepldadgqnenrsrgpdshl gnla
                          a  adeg r l pcdadfeahtf lgn a dga nsp    gsadklde vv--
                              -       h n g   gm   fe l      le    rpe  e   d   
                                               f              a     f       a   

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .       ..:*. :.*:*                             :                           
sappAlwvekkygrqLrrmsDeFdilldkg--rvksanttrqmrrspswfsflwsskesdarsrp---------------
mpvggmsaatliaqk qlig q --yyc--mk-----gsqpltyq--ghaaimlmhdlpgrevq-flrrramtsssvism
amda egp mav  e  e     ntwq-qm hegarg-nak lqavneavi-v fn--iegvl-faes c          
---- i k iq            qr--eh   arngrd-la wwvpsvetyt  agrfe---evwr              
                        q       h  q  rgq vksiad lfs    ld-nsganv               
                                      he  hh   c                r               

     
....:
     
-----
lhmqi
     
     
     
     
© 1998-2020Legal notice