Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus grahami

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A672JWL9_BMF-01       ------MDEDEDDVRRKGLQHWPSSRVQIKQTETAGI-------------
A0A672JWL9_BMF-02       ------MDEDEDDVRRKGLQHWPSSRVQIKQTETAGI-------------
A0A672LB88_BAD-01       MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTL-------------
A0A672R7P6_BAD-01       MDKRLHDHRNDSSTLNDRKKGREETINTRGQHQDQTL-------------
A0A672RGH0_BAD-01       MAQMFSISDNESETETSEDCEESGQVKNNSGSPQRTQ-------------
A0A672SAE4_BAD-01       MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTN-------------
A0A672SAE4_BAD-02       MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTN-------------
A0A672RK14_BMF-01       -------MDDEEDEQLPHCCETPLRNKSSENRDGRGGEVGQTANRHGRFE
A0A672L1R2_BCL2L11      -------MSD---------------T-SREQTPGRGS---------GESA
A0A672PQD1_BCL2L11      -------MSD---------------TSSREQTPGRGS---------GESA
                                 :                                        

A0A672JWL9_BMF-01       --------------------------------------------------
A0A672JWL9_BMF-02       --------------------------------------------------
A0A672LB88_BAD-01       --------------------------------------------------
A0A672R7P6_BAD-01       --------------------------------------------------
A0A672RGH0_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-01       --------------------------------------------------
A0A672SAE4_BAD-02       --------------------------------------------------
A0A672RK14_BMF-01       DRSTQTASSVLNSVRNGDMAPFQGLEGDASSPCRAVDARTAFGVNCGTGG
A0A672L1R2_BCL2L11      GGAAVLGSGHFDFPQPSDGDPLRG------------------GIAMSSSH
A0A672PQD1_BCL2L11      GGAAVLGSGHFDFPQPSDGDPLRG------------------GIAMSSSH
                                                                          

A0A672JWL9_BMF-01       ---------PPLCPSGMLPCRVHVEPRRFLYGNTGLLLLAPP---SRSRP
A0A672JWL9_BMF-02       ---------PPLCPSGMLPCRVHVEPRRFLYGNTGLLLLAPP---SRSRP
A0A672LB88_BAD-01       ---------PNISPQGRVRLYSESQVYTVSRWQEAEPQDGALVEENGGTG
A0A672R7P6_BAD-01       ---------PNISPQGRVRLYSESQVYMVSRWQEAEPQDGASAEENGGTG
A0A672RGH0_BAD-01       ---------H-LAVPGRLKGEQLGRHRNLSMNDEDLLETGAA--DEGDLV
A0A672SAE4_BAD-01       ---------HDLAVPDRLKGEQLGRHRNLSMNDEDLLETGAA--DEGDLV
A0A672SAE4_BAD-02       ---------HDLAVPDRLKGEQLGRHRNLSMNDEDLLETGAA--DEGDLV
A0A672RK14_BMF-01       LASLTMAPGASEGPRALFHGNAGFRAHFPALFEPLLDGTQNAEEDEGRPE
A0A672L1R2_BCL2L11      QSRSPMSRTFSRSSSGYFSVDSDSVPSSPLM--PNISEAQDGQNDEVWSA
A0A672PQD1_BCL2L11      QSRSPMCRTFSRSSSGYFSVDSDSVPGSPLM--PNISEAQDGPNDEVWFA
                                         .                           .    

A0A672JWL9_BMF-01       PDVVLRQNLRMMDPAESVETLIGQKLQLIGDQF--YQEHMMHHRNQRNRE
A0A672JWL9_BMF-02       PDVVLRQNLRMMDPAESVETLIGQKLQLIGDQF--YQD-----------A
A0A672LB88_BAD-01       DGLPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKG--EVKRANSQ
A0A672R7P6_BAD-01       DGLPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKG--EVKRANSQ
A0A672RGH0_BAD-01       GGDPFRPRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTT
A0A672SAE4_BAD-01       GGDPFRPRSRSAPPALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTT
A0A672SAE4_BAD-02       GGDPFRPRSRSAPPALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTT
A0A672RK14_BMF-01       EKEDERDV------GISVEIQIGRKLREMGDQFQQ------------DHL
A0A672L1R2_BCL2L11      EPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQG--AGAGGNNA
A0A672PQD1_BCL2L11      EPSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQG--AGAGGNNG
                             .        .       ..:*. :.*:*                 

A0A672JWL9_BMF-01       PLWWRVAVAFYTLLFGREPNARANRR-------------------
A0A672JWL9_BMF-02       PLHKSVPCAVF-VLAGLFPDSGLVV--------------------
A0A672LB88_BAD-01       KQTYR--GWFSFLWSSKEEEGRE----------------------
A0A672R7P6_BAD-01       KQTYR--GWFSFLWSSKDEEGRE----------------------
A0A672RGH0_BAD-01       RQMRQSPSWLAFLWSHKESDAESRPAE------------------
A0A672SAE4_BAD-01       RQMQQSPSWFAFLWSHKESDAESRPAE------------------
A0A672SAE4_BAD-02       RQMQQSPSWFAFLWSHKESDAESRPAE------------------
A0A672RK14_BMF-01       QLVRVISDETSSLWFS------LQWFLSRCAMTSSSVISMLHMQI
A0A672L1R2_BCL2L11      AQLRAPNEHAIIMWMNDLIGRVVQFFLRRR---------------
A0A672PQD1_BCL2L11      AQLHAPNEHAIIMWMNDLIGRVVQFFLRRR---------------
                                    :                                

© 1998-2020Legal notice