Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus grahami

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A672JWL9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BMF (length=143 residues).
MDEDEDDVRRKGLQHWPSSRVQIKQTETAGIPPLCPSGMLPCRVHVEPRRFLYGNTGLLLLAPPSRSRPPDVVLRQNLRM
MDPAESVETLIGQKLQLIGDQFYQEHMMHHRNQRNREPLWWRVAVAFYTLLFGREPNARANRR
>gnl|bcl2dbpro|A0A672JWL9_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BMF (length=130 residues).
MDEDEDDVRRKGLQHWPSSRVQIKQTETAGIPPLCPSGMLPCRVHVEPRRFLYGNTGLLLLAPPSRSRPPDVVLRQNLRM
MDPAESVETLIGQKLQLIGDQFYQDAPLHKSVPCAVFVLAGLFPDSGLVV
>gnl|bcl2dbpro|A0A672L1R2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BCL2L11 (length=176 residues).
MSDTSREQTPGRGSGESAGGAAVLGSGHFDFPQPSDGDPLRGGIAMSSSHQSRSPMSRTFSRSSSGYFSVDSDSVPSSPL
MPNISEAQDGQNDEVWSAEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAAQLRAPNEHAIIMW
MNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A672LB88_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=147 residues).
MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDGALVEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSSKEEEGRE
>gnl|bcl2dbpro|A0A672PQD1_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BCL2L11 (length=177 residues).
MSDTSSREQTPGRGSGESAGGAAVLGSGHFDFPQPSDGDPLRGGIAMSSSHQSRSPMCRTFSRSSSGYFSVDSDSVPGSP
LMPNISEAQDGPNDEVWFAEPSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNGAQLHAPNEHAIIM
WMNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A672R7P6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=147 residues).
MDKRLHDHRNDSSTLNDRKKGREETINTRGQHQDQTLPNISPQGRVRLYSESQVYMVSRWQEAEPQDGASAEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSSKDEEGRE
>gnl|bcl2dbpro|A0A672RGH0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=152 residues).
MAQMFSISDNESETETSEDCEESGQVKNNSGSPQRTQHLAVPGRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDPF
RPRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A672RK14_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BMF (length=214 residues).
MDDEEDEQLPHCCETPLRNKSSENRDGRGGEVGQTANRHGRFEDRSTQTASSVLNSVRNGDMAPFQGLEGDASSPCRAVD
ARTAFGVNCGTGGLASLTMAPGASEGPRALFHGNAGFRAHFPALFEPLLDGTQNAEEDEGRPEEKEDERDVGISVEIQIG
RKLREMGDQFQQDHLQLVRVISDETSSLWFSLQWFLSRCAMTSSSVISMLHMQI
>gnl|bcl2dbpro|A0A672SAE4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=153 residues).
MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDP
FRPRSRSAPPALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A672SAE4_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus grahami GN=BAD (length=153 residues).
MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDP
FRPRSRSAPPALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
© 1998-2020Legal notice