Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        :   .                                                           :  . .  
------msddesdtrrkglqgrps--------------------------------srvqqsqsptattpplspsgrlpc
mdqmlsidenddsvltskkkrwsegesagggavvrsgyfdfpqpsdgdplrggismtnknikrteqqglhsvavqdmvsv
 antfhdhqttteqendedceegg         l   h                a qishngghqmsrrfnr sp yfrg
  kr  v   srq ----tpsded                                ltnth    drkq -i      kl
              wan pah                                    a        k n d        f
                                                                  c             

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            :                          .  ..      .                   ..:*. :.*:
rslseprrflmgnegllqdga-de---------pfrprsrsappalwlakky------------------grqLrrigDe
yvhvrvysvsywqisep----n--vwlvtgdglllaspvqmqaadvvmrqelrmmdpavarpersvetliaqk qlms q
eqegqhtnp rpdaa aet qaa gngggs    shqha  r  vgakgpdm           e    av  e       
d d v stl  n tn      s  edsae       g          a  n                             
  n m gm      d      l    f                                                     
                                                                                

       170       180       190       200       210       220  
....:....|....:....|....:....|....:....|....:....|....:....|..
*     :                   .                                   
Fd-lydkgm-vvkvgnttrqnrrs-swfiilwsnke---------------gr---------
 -t-lqeh-mrsrsassqpvtyqpvrhisfmlmld-slvytrafsmcrvlf--vvsfflrrr
 nrw cq  kegar-gndkrmvf-pg aa-a-chaleegrskpaefytlci  tpqaran  
  i       ah g -gna lqa ne rv - --- adaee  va        e n      
          h  -  -gq   e lw l     s                            
                 a               p                            
© 1998-2020Legal notice