Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671M057_BCL2L11      ------MSDTSREQ----TPGRGSGESAGGGAVVRSGYFDFPQPSDGDPL
A0A671SJ75_BCL2L11      ------VSDTTTQTLANGPASRGSGESAGGGAVLRSGHFDFPQPSDGDPL
A0A671M0H4_BMF-02       ------MDEDEDDVRRKGLQRWPS--------------------------
A0A671M0H4_BMF-01       ------MDEDEDDVRRKGLQRWPS--------------------------
A0A671MNR9_BMF-01       ------MDEDEDDVRRKGLQHWPS--------------------------
A0A671PX91_BAD-01       MDNTLHDHQDDSSTWNDKKKGREE--------------------------
A0A671SBB4_BAD-01       MDKRLHDHQNDSSTLNDKKKGREE--------------------------
A0A671NP27_BAD-01       MAQMFSISDNESDTETSEDCEDSD--------------------------
A0A671RUV0_BAD-01       MAQMFSISDNESETETSEDCEESG--------------------------
                                :   .                                     

A0A671M057_BCL2L11      RGGISMSNSHQSRSPMCRTFSRSSSGYFSVDSDSVPGSPLMPNISEAQDG
A0A671SJ75_BCL2L11      RGGIAMSNSHQSRSPMSRTFSRSSSGYFSVDSDSMPSSPLMPNISEAQDG
A0A671M0H4_BMF-02       ------SRVQIKQTETAGTPPVSPSGMLPCRVHVEPTRFLYGNAGLL---
A0A671M0H4_BMF-01       ------SRVQIKQTETAGTPPVSPSGMLPCRVHVEPTRFLYGNAGLL---
A0A671MNR9_BMF-01       ------SRVQIKQTETAGRPPLSPSGMLPCRVNVEPRRFLYGNTGLL---
A0A671PX91_BAD-01       ------TIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDG
A0A671SBB4_BAD-01       ------TINTHGQHQDQTLPNISPQGRVRFYSESQVYMVSRWQEAEPQDG
A0A671NP27_BAD-01       ------LTKNNSGSPQKTNHDLAVPDRLKGEQLGRHRNLSMNDENLLETG
A0A671RUV0_BAD-01       ------QAKNNSGSPQRKQH-LAVPDRLKGEQLGRHRNLSMNDEDLLETG
                                              :  . .              :       

A0A671M057_BCL2L11      QNDEVWFAE----PSHQHAQMAAPVGAMGPEM----------------AV
A0A671SJ75_BCL2L11      QNDEVWSAE----PSHQHVQMAAPVGAMGPEM----------------AV
A0A671M0H4_BMF-02       -------------LLASPSRSQPPDVVLRQDLRMMDPAVARPERSVETLI
A0A671M0H4_BMF-01       -------------LLASPSRSQPPDVVLRQDLRMMDPAVARPERSVETLI
A0A671MNR9_BMF-01       -------------LLAPPSRSRPPDVVLRQNLRMMDPA-----ESVETLI
A0A671PX91_BAD-01       ALAEENGGTGDGLPFRGRSQSAPAALWKAKKY------------------
A0A671SBB4_BAD-01       ASAEENGGTGDGLPFRGRSQSAPAALWKAKKY------------------
A0A671NP27_BAD-01       AADEGDLVGSD--PFRPRSRSAPPALWAAKKY------------------
A0A671RUV0_BAD-01       AADEGDLVGGD--PFRPRSRSAPPALWAAKKY------------------
                                           .  ..      .                   

A0A671M057_BCL2L11      ARELRRIGDEFNRLYCQG--AGAGGNNGAQLRAPNEHAIIMWMND-----
A0A671SJ75_BCL2L11      ARELRRIGDEFNRLYCQG--AGAGGNNAAQLRAPNEHAIIMWMND-----
A0A671M0H4_BMF-02       GQKLQLIGDQF---YQEHMMVSRVGSGDPVNVFSVRWIIIALCLALALVY
A0A671M0H4_BMF-01       GQKLQLIGDQF---YQEHMMVSRVGSGDPVNVFSVRWIIIALCLALALVY
A0A671MNR9_BMF-01       GQKLQLIGDQF---YQEHMMHHR----NQRNREPLWWRV-----------
A0A671PX91_BAD-01       GRQLRRMSDEFDTWLDKG--EVKRANSQKQTYR--GWFSFLWSPKEEEGR
A0A671SBB4_BAD-01       GRQLRRMSDEFDTWLDKG--EVKRANSQKQTYR--GWFSFLLSSKEEEGR
A0A671NP27_BAD-01       GRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAE
A0A671RUV0_BAD-01       GQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAE
                        ..:*. :.*:*     :                   .             

A0A671M057_BCL2L11      ---------LIGRVVQFFLRRR
A0A671SJ75_BCL2L11      ---------LIGRVVQFFLRRR
A0A671M0H4_BMF-02       TKAFSMCRVCFGRTVS------
A0A671M0H4_BMF-01       TKAFSMCRVCFGRTVS------
A0A671MNR9_BMF-01       --AVAFYTLLFGREPNARANRR
A0A671PX91_BAD-01       E---------------------
A0A671SBB4_BAD-01       E---------------------
A0A671NP27_BAD-01       SRPAE-----------------
A0A671RUV0_BAD-01       SRPAE-----------------
                                              

© 1998-2020Legal notice