Dataset for protein classical BH3-containing proteins of organism Sinocyclocheilus anshuiensis

[Download (right click)] [Alignment] [Repertoires]

9 sequence(s)

>gnl|bcl2dbpro|A0A671M057_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BCL2L11 (length=176 residues).
MSDTSREQTPGRGSGESAGGGAVVRSGYFDFPQPSDGDPLRGGISMSNSHQSRSPMCRTFSRSSSGYFSVDSDSVPGSPL
MPNISEAQDGQNDEVWFAEPSHQHAQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNGAQLRAPNEHAIIMW
MNDLIGRVVQFFLRRR
>gnl|bcl2dbpro|A0A671M0H4_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BMF (length=159 residues).
MDEDEDDVRRKGLQRWPSSRVQIKQTETAGTPPVSPSGMLPCRVHVEPTRFLYGNAGLLLLASPSRSQPPDVVLRQDLRM
MDPAVARPERSVETLIGQKLQLIGDQFYQEHMMVSRVGSGDPVNVFSVRWIIIALCLALALVYTKAFSMCRVCFGRTVS
>gnl|bcl2dbpro|A0A671M0H4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BMF (length=159 residues).
MDEDEDDVRRKGLQRWPSSRVQIKQTETAGTPPVSPSGMLPCRVHVEPTRFLYGNAGLLLLASPSRSQPPDVVLRQDLRM
MDPAVARPERSVETLIGQKLQLIGDQFYQEHMMVSRVGSGDPVNVFSVRWIIIALCLALALVYTKAFSMCRVCFGRTVS
>gnl|bcl2dbpro|A0A671MNR9_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BMF (length=143 residues).
MDEDEDDVRRKGLQHWPSSRVQIKQTETAGRPPLSPSGMLPCRVNVEPRRFLYGNTGLLLLAPPSRSRPPDVVLRQNLRM
MDPAESVETLIGQKLQLIGDQFYQEHMMHHRNQRNREPLWWRVAVAFYTLLFGREPNARANRR
>gnl|bcl2dbpro|A0A671NP27_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BAD (length=153 residues).
MAQMFSISDNESDTETSEDCEDSDLTKNNSGSPQKTNHDLAVPDRLKGEQLGRHRNLSMNDENLLETGAADEGDLVGSDP
FRPRSRSAPPALWAAKKYGRQLRRMSDEFDILLDKGMKRVKSAGTTRQMQQSPSWFAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A671PX91_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BAD (length=147 residues).
MDNTLHDHQDDSSTWNDKKKGREETIKNQGQHQDQTLPNISPQGRVRLYSESQVYTVSRWQEAEPQDGALAEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLWSPKEEEGRE
>gnl|bcl2dbpro|A0A671RUV0_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BAD (length=152 residues).
MAQMFSISDNESETETSEDCEESGQAKNNSGSPQRKQHLAVPDRLKGEQLGRHRNLSMNDEDLLETGAADEGDLVGGDPF
RPRSRSAPPALWAAKKYGQQLRRMSDEFDILLDKGMKRVKSAGTTRQMRQSPSWLAFLWSHKESDAESRPAE
>gnl|bcl2dbpro|A0A671SBB4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BAD (length=147 residues).
MDKRLHDHQNDSSTLNDKKKGREETINTHGQHQDQTLPNISPQGRVRFYSESQVYMVSRWQEAEPQDGASAEENGGTGDG
LPFRGRSQSAPAALWKAKKYGRQLRRMSDEFDTWLDKGEVKRANSQKQTYRGWFSFLLSSKEEEGRE
>gnl|bcl2dbpro|A0A671SJ75_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Sinocyclocheilus anshuiensis GN=BCL2L11 (length=180 residues).
VSDTTTQTLANGPASRGSGESAGGGAVLRSGHFDFPQPSDGDPLRGGIAMSNSHQSRSPMSRTFSRSSSGYFSVDSDSMP
SSPLMPNISEAQDGQNDEVWSAEPSHQHVQMAAPVGAMGPEMAVARELRRIGDEFNRLYCQGAGAGGNNAAQLRAPNEHA
IIMWMNDLIGRVVQFFLRRR
© 1998-2020Legal notice