Dataset for protein classical BH3-containing proteins of organism Salmo trutta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                      .                         
----------------------------------------------------psdnpqdcvdpq-s-c----------sd
qslssrsrpyysnlsvlsmssgsygelspgggaasllsrplrlplplslsae-mshthsvfvdds-h-wrtafreiky--
mnkiylqqnlqlsgwtillerlksspsn llsls               r smd eedlsesesqlsglsltsnsspeep
  d  kklg lc   saiidq ep   h                     g   t s lf lr n  r  pesml qdl  
                                                             g c  l             
                                                             e                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         : :                        . : :     .                                 
-s--t-spglqlpnsllptqsssrprp-ls--sggrlsfysesqvss---------------------------------
r-tt-p--eimm---mvsfgvrqpvfrt--rs-sfyvrlpadfipvglslclssfpsplsppllkdskstqtpspssqvm
hggqshysvfpi spysgcttanellllfygnapepfh d rlerc                  slnl sps lsppspl
p pl lnlp l   nh  lsmlil   s  sl  s    l q lq                                  i
        a a   h    r                     p  l                                   
              d                                                                 

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
thalqrmsrasetprdyskspvwpnplslpllslflclfslslplfslsasppvslslssrlfppfplsislpslstplp
slp lsl qsqlsnsplgaahpf l  r                                                    
        l l  g      da     h                                                    
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------------------g--
lhltaflfplltssssvdvsmaqmftisdsesepseevgetekdqssagkgmtggpightltvpemrlagegrlrqv-pr
                                                                           dqsrs
                                                                           mn kq
                                                                              el
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      *                * :*. :.*:*            .        . :      
e--e-----------g-dgapfRsrsqsappalwaekliGqqLqrigDeFdtwli--rlyprngrvprgnwqrmssgpft
-dt-fqdvmtpteeg-g---sy l-ppptqgdmspaiky rk rlms q nqlhdhrqgahkrqqnmqpllwqvhrewas
qqqrl grgpgv gvper rme gn--lqa vrrm vc  ce        ynev-  kvvem risagevkrklaqalsf
gehq            t  g   p q     tq i tr            hd iv  dkggg  vksa gakh tks lw
 a                                                    l    e     i   a  e       
                                                                                

       410       420      
....:....|....:....|....:.
  :                       
llwsqlliggre----r---------
f-fmpkaaerllriiw-rripprsse
 eyeksakgtqagltpt       
   as f h egetehq         
    g e                   
                          
© 1998-2020Legal notice