Dataset for protein classical BH3-containing proteins of organism Salmo trutta

[Download (right click)] [Alignment] [Repertoires]

7 sequence(s)

>gnl|bcl2dbpro|A0A673WET2_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Salmo trutta GN=BCL2L11 (length=214 residues).
MSDSSRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSERDQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSG
YFSFDSDSIPSSPLLKDNKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPPTAGDMWPETLIGQELQ
RIGDEFNDLVIHRLAEGNGQVAQENLQQMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A673XGV4_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Salmo trutta GN=BCL2L11 (length=218 residues).
QNKIYKKRGYYCNLWVAIMDQGESGESHPGGGAASRAEPSDNPQSCEGDQQSLGGIMIPNSLLGFQSRSPVFRTLSRSSS
GYFSFDSDSIPSSPLLKDKSTQTPSPSSQVITHALQRMSRALETGRDYGKAHVWPNPLRPYRSRPPPTAGDMRPEILIGQ
ELQRIGDEFNNLIIHRRLAGRNGQVAQGNLQHMHQEPAFLLWMSLLIGRLLQIILRRR
>gnl|bcl2dbpro|A0A673YQV3_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salmo trutta GN=BMF (length=162 residues).
MDDEEDDVFEPDSHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGERGGMERLNQQPQQPARSIEICIGQKLQLIGDQFHQEHVQVYHRNQRNMRPLWRRLASALLTLLFEQEAIAGGERAG
WR
>gnl|bcl2dbpro|A0A673ZHY7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo trutta GN=BAD (length=156 residues).
MDHTHDCVDDNPETMNEQDESDHSGTTHYPEFQLHYVSTRTSIRPRPGERVRLYSESQVCSQVGRREDTEFQDVMTPTEE
GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPKKAEGRE
>gnl|bcl2dbpro|A0A674AVP9_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo trutta GN=BAD (length=147 residues).
MDHTHDCVDECESDHSGTTHNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A674DKC6_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo trutta GN=BAD (length=420 residues).
SLSSLSLPLLLSLSSLSLSSLSPSPLSPLLSLSSLLSRPLRLPLPLSLSASPSSSPLLCLSPSSLSCLSLSSLSSPLSPP
SPLSLSLPLLLPSPLSPLSSLSLPLLSLSSLSPSPLSLLSPLLLSSLSLCLSSFPSPLSPPLLSLSLSSPSPLSPPSPLS
LPLLSLSLSSLSPSPLSASPPFPLPLSLPLLSLFLCLFSLSLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPL
HLTAFLFPLLTSSSSVDVSMAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHTLTVPEMRLAGEGRLRMNSESQ
AQELQGRGPGVEGVPTDGASFRGRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYL
FSHKETETEHTPTIPPRSSE
>gnl|bcl2dbpro|A0A674EF64_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salmo trutta GN=BMF (length=161 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDQGPQ
EQHQGERGRMERLLQQPVQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPLWWRLASALFTLLFEQEAIAGRGRAGW
R
© 1998-2020Legal notice