Dataset for protein classical BH3-containing proteins of organism Salmo trutta

[Download (right click)] [Edit] [Sequences] [Repertoires]

7 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A674AVP9_BAD-01       --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A674DKC6_BAD-01       -SLSSLSLPLLLSLSSLSLSSLSPSPLSPLLSLSSLLSRPLRLPLPLSLS
A0A673WET2_BCL2L11      MSDSSRQQN-QSNGSTILIERGKYGELNPGGGAAS--------------G
A0A673XGV4_BCL2L11      QNKIYKKRGYYCNLWVAIMDQGESGESHPGGGAAS--------------R
                                                                          

A0A674AVP9_BAD-01       ---MDHTHDCVDEC-------------ESDHSGTTHNSEFQL---HVSTT
A0A673ZHY7_BAD-01       ---MDHTHDCVDDN-----PETMNEQDESDHSGTTHYPEFQL--HYVSTR
A0A673YQV3_BMF-01       --MDDEEDDVFEPD-SHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCG
A0A674EF64_BMF-01       --MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCG
A0A674DKC6_BAD-01       ASPSSSPLLCLSPSSLSCLSLSSLSSPLSPPSPLSLSLPLLLPSPLSPLS
A0A673WET2_BCL2L11      AEPTDNPQFSERDQQSRG--------------------GIMMPNSLLGFQ
A0A673XGV4_BCL2L11      AEPSDNPQSCEGDQQSLG--------------------GIMIPNSLLGFQ
                            .                                  : :        

A0A674AVP9_BAD-01       MSNRPRP------GERVRLYSESQVCS-----------------------
A0A673ZHY7_BAD-01       TSIRPRP------GERVRLYSESQVCS-----------------------
A0A673YQV3_BMF-01       VAQEPRPLFYGNAGFRLHFPAQFERVG-----------------------
A0A674EF64_BMF-01       VAQEPRPLFYGNAGFRLHFPARFEQVG-----------------------
A0A674DKC6_BAD-01       SLSLPLLSLSSLSPSPLSLLSPLLLSSLSLCLSSFPSPLSPPLLSLSLSS
A0A673WET2_BCL2L11      SRSPLFRTLSRSSSGYFSFDSDSIPSS--------------PLLKDNKST
A0A673XGV4_BCL2L11      SRSPVFRTLSRSSSGYFSFDSDSIPSS--------------PLLKD-KST
                                        . : :     .                       

A0A674AVP9_BAD-01       --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A674DKC6_BAD-01       PSPLSPPSPLSLPLLSLSLSSLSPSPLSASPPFPLPLSLPLLSLFLCLFS
A0A673WET2_BCL2L11      QTPSPSSQVMTHALQRMSQAQETNRDY---DAWPNPLH------------
A0A673XGV4_BCL2L11      QTPSPSSQVITHALQRMSRALETGRDYGKAHVWPNPLR------------
                                                                          

A0A674AVP9_BAD-01       --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A674DKC6_BAD-01       LSLPLFSLSASPPVSLSLSSRLFPPFPLSISLPSLSTPLPLHLTAFLFPL
A0A673WET2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
                                                                          

A0A674AVP9_BAD-01       --------------------------------------------------
A0A673ZHY7_BAD-01       --------------------------------------------------
A0A673YQV3_BMF-01       --------------------------------------------------
A0A674EF64_BMF-01       --------------------------------------------------
A0A674DKC6_BAD-01       LTSSSSVDVSMAQMFTISDSESEPSEEVGETEKDQSSAGKGMTGGPIGHT
A0A673WET2_BCL2L11      --------------------------------------------------
A0A673XGV4_BCL2L11      --------------------------------------------------
                                                                          

A0A674AVP9_BAD-01       ---------------QVGKREDTEFQDVMTPTEEGGGDGASFRGRSQSAP
A0A673ZHY7_BAD-01       ---------------QVGRREDTEFQDVMTPTEEGGGDGAPFRSRSQSAP
A0A673YQV3_BMF-01       ---------------DQGPLGE-R-----------GERGGMERLNQQPQQ
A0A674EF64_BMF-01       ---------------DQGPQEQHQ-----------GERGRMERL---LQQ
A0A674DKC6_BAD-01       LTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGVPTDGASFRGRSQSAP
A0A673WET2_BCL2L11      ----------------------------------------PYRPRPPPTA
A0A673XGV4_BCL2L11      ----------------------------------------PYRSRPPPTA
                                                                  *       

A0A674AVP9_BAD-01       PALWAAKKYGCQLRRMSDEFDTWLD--KGVPKRGIIPRGGKQKVSRGWFS
A0A673ZHY7_BAD-01       PTLWAAKKYGRQLRRMSDEFDTWLD--KGEPKRGISPGGVKQEVSRGWFS
A0A673YQV3_BMF-01       PARSIEICIGQKLQLIGDQFHQEHV--QVYHRNQRNMRPLWRRLASALLT
A0A674EF64_BMF-01       PVQSMEVCIGQKLQLIGDQFYQEHL--QLYHRNQRNMRPLWWRLASALFT
A0A674DKC6_BAD-01       PALWAAKRYGRQLRRMSDEFDTWL---DKGEMRRVKSAGAAKQMTKSPSW
A0A673WET2_BCL2L11      GDMWPETLIGQELQRIGDEFNDLVIH-RLAEGNGQVAQENLQQMHQEPAF
A0A673XGV4_BCL2L11      GDMRPEILIGQELQRIGDEFNNLIIHRRLAGRNGQVAQGNLQHMHQEPAF
                                 * :*. :.*:*            .        . :      

A0A674AVP9_BAD-01       FLWSPKEAEGRE--------------
A0A673ZHY7_BAD-01       FLWSPKKAEGRE--------------
A0A673YQV3_BMF-01       LLFEQEAIAGGERAGWR---------
A0A674EF64_BMF-01       LLFEQEAIAGRGRAGWR---------
A0A674DKC6_BAD-01       --WAYLFSHKETETEHTPTIPPRSSE
A0A673WET2_BCL2L11      LLWMGLLIGRLLQIILQRR-------
A0A673XGV4_BCL2L11      LLWMSLLIGRLLQIILRRR-------
                          :                       

© 1998-2020Legal notice