Dataset for protein classical BH3-containing proteins of organism Salmo salar

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        :     .                                  :                .             
-------mddehddv-----------------------fep--------esdhs--gttreikfqdr-vstpspvrprpg
msqsstqsnytegctiliergkygelnpgggaasgaepddnpqtsnrhqd-sqcwrtafsnseyelhgtqfttsnlslsn
 adifriq ssses                        tvc efmeeddqnrggsmmpnmypgpis ypl rmls lsge
         q n e                        g t             ia kghtl   r sa  vpgm aa  
         h                                                  lg   g       ei     
                                                                          a     

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                     .    :                               * .              * :*.
nrl------------------rlyspsqvesvvgqgp-tefq---------ggdgasfRlrsqsappalwaekkyGqqLr
gmvpcgvaqeprplfygnagfqthfeasfcrqgdrred---ldvmtpteeg-erlgme gnq-pqqgtrsiaici rk q
efsfdsdsipss vlkd kst mp   rqvqtqakqrqvqhmptnrdydawp-p rpy sq-p-ta dq p vr  ce  
y                      n    armlh l dns g e         n  h   p p      m m tl      
d                            qe      me a                                       
                                     g                                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :.*:*                             .    .                 :         :           
rmsDeFdt------------------------wldkgvpkrgi-p--------glkqrvsr--gwfsfl------wsqke
lig q hqehvqvvripnvtdctaqlkpteqayhrnqrnmn--i-rkwllyghpgwwqlasspalltwmglligrfepea
      ydl l l                   vmtrremr evvsq       evlskmtve sfwll       vlhik
      n                          chqlsdg  tsqg        ncre hq  pc fy       l ehi
                                      ae  qkaa        mak   k     a             
                                           e          a                         

       250     
....:....|....:
               
aegre----------
latg-ragwrprste
iqrestptiy pks 
t qchdlsfp     
    g          
               
© 1998-2022Legal notice