Dataset for protein classical BH3-containing proteins of organism Salmo salar

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1S3SAH9_BCL2L11      MSDSSRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSERDQQ
A0A1S3SNN2_BMF-01       -------MDDEEDDV-----------------------FVP--------D
A0A1S3P5K4_BMF-01       -------MDDEEDDV-----------------------FEP--------D
A0A1S3P5K4_BMF-02       -------MDDEEDDV-----------------------FEP--------D
B5X1T1_BAD-01           -------MDHTHDCV-----------------------DDNPETMNEHDE
A0A1S3N9Q3_BAD-01       MAQIFTISDSESEEV-----------------------GET--------E
A0A1S3L0Z2_BAD-01       -------MDYTHDCV-----------------------DEC--------E
B5XEF1_BAD-01           -------MDYTHDCV-----------------------DEC--------E
                                :     .                                  :

A0A1S3SAH9_BCL2L11      SRGGIMMPNSLLGFQSRSPLFRTLSRSSSGYFSFDSDSIPSSPVLKDNKS
A0A1S3SNN2_BMF-01       SSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAG
A0A1S3P5K4_BMF-01       -SHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAG
A0A1S3P5K4_BMF-02       -SHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAG
B5X1T1_BAD-01           SDHS--GTTHYPEFQRHYVSTRTGIRPRPGGRV-----------------
A0A1S3N9Q3_BAD-01       NDQSSAGKGMTGGPIGH-ALTVPEMRLAGEGRL-----------------
A0A1S3L0Z2_BAD-01       SDHS--GTTRNSEFQLH-VSTTMSNRPRPGERV-----------------
B5XEF1_BAD-01           SDHS--GTTRNSEFQLH-VSTTMSNRPRPGERV-----------------
                                        .                                 

A0A1S3SAH9_BCL2L11      TQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPPTAGDMW
A0A1S3SNN2_BMF-01       FRLHFPARFEQVGDQGPQEQHQ---------GERGRMERLQ---QQPAQS
A0A1S3P5K4_BMF-01       FRLHFPAQFERVGDQGP----L---------GERGGMERLNQQPQQPARS
A0A1S3P5K4_BMF-02       FRLHFPAQFERVGDQGP----L---------GERGGMERLNQQPQQPARS
B5X1T1_BAD-01           -RLYSESQVCSQVGRRDNTEFQDVMTPTEEGGGDGAPFRSRSQSAPPTLW
A0A1S3N9Q3_BAD-01       -RMNSESQAQELQGRGPGVEGMPT---------DGASFRGRSQSAPPALW
A0A1S3L0Z2_BAD-01       -RLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFRGRSQSAPPALW
B5XEF1_BAD-01           -RLYSESQVRSQVGKREDTEFQDVMTPTEEGGGDGASFRGRSQSAPPALW
                         .    :                               * .         

A0A1S3SAH9_BCL2L11      PETLIGQELQRIGDEFNDL-----------------------VMHRLVDG
A0A1S3SNN2_BMF-01       MEVCIGQKLQLIGDQFYQEHLQL-------------------YHRNQRNM
A0A1S3P5K4_BMF-01       IEICIGQKLQLIGDQFHQEHVQVVRIPNVTDCTAQLKPTEQAYCTQRSAE
A0A1S3P5K4_BMF-02       IEICIGQKLQLIGDQFHQEHVQV-------------------YHRNQRNM
B5X1T1_BAD-01           AAKKYGRQLRRMSDEFDT------------------------WLDKGEPK
A0A1S3N9Q3_BAD-01       AAKRYGRQLRRMSDEFDT------------------------WLDKGEMR
A0A1S3L0Z2_BAD-01       AAKKYGCQLRRMSDEFDT------------------------WLDKGVPK
B5XEF1_BAD-01           AAKKYGCQLRRMSDEFDT------------------------WLDKGVPK
                             * :*. :.*:*                             .    

A0A1S3SAH9_BCL2L11      NGQVAQ-------ENLQQMHQEPAFLLWMGLLIGRLLQIILQRR------
A0A1S3SNN2_BMF-01       R------------PMWWRLAS--ALFTLL------FEQEAIAGRGRAGWR
A0A1S3P5K4_BMF-01       RETEQQKWLLYGHPLCSRLSV--PCLFWL------VSEHALAQCSDLSFY
A0A1S3P5K4_BMF-02       R------------PLWRRLAS--ALLTLL------FEQEAIAGGERAGWR
B5X1T1_BAD-01           RGISPG-------GVKQEVSR--GWFSFL------WSPKKAEGRE-----
A0A1S3N9Q3_BAD-01       R-VKSA-------GAAKQMTKSPSWWAYL------FSHKETETEHTPTIP
A0A1S3L0Z2_BAD-01       RGIIPR-------GGKQKVSR--GWFSFL------WSPKEAEGRE-----
B5XEF1_BAD-01           RGIIPR-------GGKQKVSR--GWFSFL------WSPKEAEGRE-----
                        .                 :         :                     

A0A1S3SAH9_BCL2L11      -----
A0A1S3SNN2_BMF-01       -----
A0A1S3P5K4_BMF-01       PPKT-
A0A1S3P5K4_BMF-02       -----
B5X1T1_BAD-01           -----
A0A1S3N9Q3_BAD-01       PRSSE
A0A1S3L0Z2_BAD-01       -----
B5XEF1_BAD-01           -----
                             

© 1998-2022Legal notice