Dataset for protein classical BH3-containing proteins of organism Salmo salar

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A1S3L0Z2_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo salar GN=BAD (length=147 residues).
MDYTHDCVDECESDHSGTTRNSEFQLHVSTTMSNRPRPGERVRLYSESQVCSQVGKREDTEFQDVMTPTEEGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQKVSRGWFSFLWSPKEAEGRE
>gnl|bcl2dbpro|A0A1S3N9Q3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo salar GN=BAD (length=158 residues).
MAQIFTISDSESEEVGETENDQSSAGKGMTGGPIGHALTVPEMRLAGEGRLRMNSESQAQELQGRGPGVEGMPTDGASFR
GRSQSAPPALWAAKRYGRQLRRMSDEFDTWLDKGEMRRVKSAGAAKQMTKSPSWWAYLFSHKETETEHTPTIPPRSSE
>gnl|bcl2dbpro|A0A1S3P5K4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salmo salar GN=BMF (length=194 residues).
MDDEEDDVFEPDSHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNQQPQQPARSIEICIGQKLQLIGDQFHQEHVQVVRIPNVTDCTAQLKPTEQAYCTQRSAERETEQQKWLLYG
HPLCSRLSVPCLFWLVSEHALAQCSDLSFYPPKT
>gnl|bcl2dbpro|A0A1S3P5K4_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Salmo salar GN=BMF (length=159 residues).
MDDEEDDVFEPDSHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNQQPQQPARSIEICIGQKLQLIGDQFHQEHVQVYHRNQRNMRPLWRRLASALLTLLFEQEAIAGGERAGWR
>gnl|bcl2dbpro|A0A1S3SAH9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Salmo salar GN=BCL2L11 (length=214 residues).
MSDSSRQQNQSNGSTILIERGKYGELNPGGGAASGAEPTDNPQFSERDQQSRGGIMMPNSLLGFQSRSPLFRTLSRSSSG
YFSFDSDSIPSSPVLKDNKSTQTPSPSSQVMTHALQRMSQAQETNRDYDAWPNPLHPYRPRPPPTAGDMWPETLIGQELQ
RIGDEFNDLVMHRLVDGNGQVAQENLQQMHQEPAFLLWMGLLIGRLLQIILQRR
>gnl|bcl2dbpro|A0A1S3SNN2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salmo salar GN=BMF (length=161 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDQGPQ
EQHQGERGRMERLQQQPAQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPMWWRLASALFTLLFEQEAIAGRGRAGW
R
>gnl|bcl2dbpro|B5X1T1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo salar GN=BAD (length=156 residues).
MDHTHDCVDDNPETMNEHDESDHSGTTHYPEFQRHYVSTRTGIRPRPGGRVRLYSESQVCSQVGRRDNTEFQDVMTPTEE
GGGDGAPFRSRSQSAPPTLWAAKKYGRQLRRMSDEFDTWLDKGEPKRGISPGGVKQEVSRGWFSFLWSPKKAEGRE
>gnl|bcl2dbpro|B5XEF1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Salmo salar GN=BAD (length=147 residues).
MDYTHDCVDECESDHSGTTRNSEFQLHVSTTMSNRPRPGERVRLYSESQVRSQVGKREDTEFQDVMTPTEEGGGDGASFR
GRSQSAPPALWAAKKYGCQLRRMSDEFDTWLDKGVPKRGIIPRGGKQKVSRGWFSFLWSPKEAEGRE
© 1998-2022Legal notice