Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------makqpsdvssecdregrql----------qPaerppqlr-------------------------
msikfgvgsaracpcq-------------------slsmfqipefmdgpqerga-rlvpsavscglcepglaatpaapal
  gvrp srdilmetlvprasqatwvplqicvtrprhglrpqhleeaskkads-q gpg                     
                lymerlrcvemeeddepdeeedpdemed t edgmfknl                         
                  e l eplt  vvg fa     a     s vgtlep a                         
                       g    pl  l            r las  l g                         
                                             g   c  d                           
                                             d                                  
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------pgaptslqtepqgn-ped--nhggegd----cp----qgplappasp---------
lpaaylcaptappavtaalggprwssssrrappgaa-dr---sr-------lsps--hgsp----------trrhrrpgg
                        qpgelgrglsvrs-lgsqllrlhrqapchedsqlsrlrllpldhshq         
                        err-aqhdaflpvtqatvagkqaalll   vmmvplapcfkwtaccg         
                        adpvqp yrtciplgmqt psnrerpg   ra rhftlakiyrsttd         
                          m  a rgr eleeepp  pfpdkhq   g    ag  a  lqpr          
                               a a   ac g   da    n   e           gghd          
                                        d         i   a                         
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
pplawgspqpaprptpgrssalalaggaapgvagaqrpggpggrshpggpgsprgggtvgpgdrgpaaadggrpqravra
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------p-atrsp---f-r---llsrsssgyfsfdtdrspapmscdkstqtpsppcqafnhylsamasrrqae---
aetrgaaatg-f-----lfi-m-rss------------------q-------grr----adt-asa-lllvlp----pad
         pglrptgsedgwtqtlgpqlprqgyplpaqvterr-evfyrqa---lllwp-ly-pqv---ptmllhrave
         qeqpls qhhkgageieaaqlpwavmancgyeaetrrldveeqrhstrav-v-srlimgfrl--peeavpv
         irpvve fvqsaytlvattmghmyddngvels nmvcyptadrwgqspvgrtvlea-gdtigwwngtvswt
         aadg   emeqh  ap nra fr preqt eg g sarmsqpisykrn  sspwl-ksypfevqipssqts
                        k  i  a  he es da c e e lpn epgme   nfp qdrqnacrlemdgnlq
                                                 gf  a      ed  e qpg -nkdfcdlkk
                                                                    c iii    gf 
                                                                       ef    e  
                                                                       ae       

       330       340       350       360       370        
....:....|....:....|....:....|....:....|....:....|....:...
                                                          
----------------------------------------------------------
mrpeiriaqelrrigdefnayyarrvflnnyqaaeehpqmvilrllryivrlvwrmhr
leanllwrptvqwapttthrrrvyvwwrypaswwwrtlprphtspsqsemnrssggp 
hsrlgqtkrksltfafqrtqlqtssltkwrqrvtqqrellnsslgqngdeaanga   
gilkv pgig ksc  p qmfhsqqhsqvlnpssddnagfllrdf h           
dgfh  l df ac   i gg elklmrnsidhhgaai   g naa             
c  g            a    de g qipf  f                         
                          e l                             
                          c                               
                          a                               
                                                          
© 1998-2021Legal notice