Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            .                   
-------------------------------------------------------mpmerprevepsspa-lqlep-p-g
mararqegsspepvmslvrpvsrpipmgtlvysqvsmalqpsgvsstcdregrqp--gfpsptqrepedtvrgtglsgp-
              egga dgp dfller lpeallepktmpdlgveraepdmfqqaekkasqnaqlasdsf-p-dq-np
                                    cg ikfv aaappc clvliea-e lklvdgvtmraaar-geaa
                                       cee     d a aql r -ls acwp dqice- -pract 
                                                     d a y d   cm c   a  g  w i 
                                                         d c   a  a           g 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
dr--dsggagrgaq--l----------pldaphgpgqrptsspdgvtg--e--srssg-pl-sfdtd-p-alms-raetq
--ps--l---dsppss-sqglsrlqsfvwapsgsqepptsrahpki--tr-sw-srwsy-ar---der-q---rreqsrs
eqsrsh-shp-qc-plsplpeqlgelplpthccqlalga-qqelfgrqrlsqllpeq-vq-ptmv--lspryf-cdkgek
admgnrakehlf- lgfdcakkh sgl--s--aa--gf-q--ah-afmeegpia--iysmyfrges enaqpeya---yr
ptadvq rrdi-m hhevrmh   lasiy-qt--ir--v vf--r-cysvqtaw q-eag ecea  sqtlrplppvasg
ge  p  pl  l     ta           l rdh evl   rs fatlt nrm ht l  g     nmseel nnt pa
                                d   dq    m     ak e   f           g e    glr c 
                                                       a                   f  a 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
trsppsqwrvqy---------enlv-g-----------------------------------------------------
qplracpsfnl-lsamlrqla-lfrmellplprphrapemtprqrrqtsswtrvrvwwwirrlprpltspsqsnrngssp
lshvstvpaahvrgrlppliewevis-wqgawkgqvktaqehnlmvrskqqr spqsfqdlnflhnsslnqhedmaaagg
sqagrqlal--ryrktvnepskvwsrsvkl r lgcisdpfatgh  qhg n nfap gaalag g aagge        
rnv gngtklnpiqeqflrmqgrhklnthi l     a g                                        
mcp  lfdeifl lce h gcfq hg f                                                    
  i  fd  e f     a f di ed a                                                    
     d               a  cc                                                      
                         a                                                      

 
.
 
-
r
g
 
 
 
 
 
 
© 1998-2020Legal notice