Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------------------------------------------------------------------makqpsdv
ikfgvgsaracpcqvprassatwvpcqicgprermspvtpvsrlplmrtlpyprrpepltmrvpgvtgsvlr--------
                                  hggrr ggqdigaerglgeqlla  paepl aldpeedpfrirefc
                                                                        llqeeqre
                                                                         dma pgg
                                                                          pm ded
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ssecdregrq-------------------------lqpaerppqlrpgaptslqtepqg---------------------
----------erglrpspagdrvrspvspplikfgpsssrkarrqaq-s---a------llwdqrpggshqreqptsssh
perqeddssarlppglhrptrlhpraggcg cwps-mdgpahhknvsr-sla-dlfapsvidaa    tgpqwpvgtrgs
vpplpvsvlrcda   fcl  e         aeg vgvekgetgaq p yartwvavlaqty l    pdgishglppfr
hl emepadm      a i                fdatg c cgl s lvlspswgaifag      g d rd  g  m
        a                          ma  d   p   l escmhgpc c  c                  
                                       l   a   a     gal     a                  
                                                     a g                        
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------nped--nhggegdscphgspqgplappasp-pfatrsplfifmrrssllsrsssgyfsfdtdrspapmscdks
pggtgtv----rl------------------------g--------------------p-------ql-k-r-e---e--
hrfptpkgtqssrslapltlesqvplrptstrgastqptlgpegseqqvyltpgvtlg-qrpdyga--par-v-vdv-qq
d  grldenlpahwyyeqhhcpgpnvaareqedkpatasppvaveveswagpilaqqermalrnnvgyg-ptrvaaptdv
   a a cagt gqsfaaetrmsehptreasplggrsraa ltlwsaghl ecarreaervdflapave cqqkyetrat
       t rm fpq  d sgedramsecmklfs  gmn  sqd r  r  al   msdnlvleqnlgy lglct gppr
         i  ada    i d l fe ak  er   l   an  a      e   alalgsgsll ew a  as fqli
                   g                                       efkegfk  l     l   ea
                                                             h   h  a         c 
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
tqtps-ppcqafnhylsamasrr---------------------------------------------------------
--r--s-wr-t-as-gd-l-l--qaepadmrpeiriaqelrrigdefnayyarrvflnnyqaaeehpqmvilrllryivr
gr-rlqg--v-y--r--l-v-plltsgpesernlsvgitsqwrnrvwwqlllyllwkylnsstqrtgalprrdfs     
rhqteksdprllqlimgfrptmpghravtqimraqtrghqlnf ft tgieefvhsnwpdhhsndne gnh         
wglqtflatdvwewawevqlawnesavtqcfhg hsqdf   c  i h fd   mnipiagee                 
qpigr   qpsprqwsqtnivkksqvssh d a                      e l                      
lm      klq  pkrlr criifeciq                           c a                      
        egn   faan gpfg d  k                           a                        
        aec   d     nee c                                                       
                    i d                                                         
                    g                                                           

      
....:.
      
------
lvwrmh
      
      
      
      
      
      
      
      
      
© 1998-2022Legal notice