Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QZT2_BBC3-02      IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRG
A0A2K6RAW1_BMF-02       ------------------------------------------MEPSRCVE
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6QK74_BIK-01       ----------------------------------------------MSGV
A0A2K6PUL3_BAD-01       --------------------------------------------------
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K6RAW1_BMF-01       ------------------------------------------MEPSRCVE
A0A2K6QZT2_BBC3-01      -----------------------------------------------MAR
A0A2K6QZT2_BBC3-04      ------------------------------------------------IK
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
A0A2K6QIJ1_BCL2L11      -----------------------------------------------MAK
                                                                          

A0A2K6NC45_PMAIP1-      -------------------------------MPGKKARKNAQPS------
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QZT2_BBC3-02      PGPRRPAPLPARPPGALGSVLRPLRARPGCHPRCPRPAARCLPLRPHRPT
A0A2K6RAW1_BMF-02       ELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPL--THCC
A0A2K6QZT2_BBC3-03      -----------------------IKFGVGSARACPCQVPRASSA--TWV-
A0A2K6QK74_BIK-01       RPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPL--ECME
A0A2K6PUL3_BAD-01       ----------------------------------MFQIPEFEPS--EQED
A0A2K6PUL3_BAD-02       ----------------------------------MFQIPEFEPS--EQED
A0A2K6RAW1_BMF-01       ELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPL--THCC
A0A2K6QZT2_BBC3-01      ARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAAT--PAA-
A0A2K6QZT2_BBC3-04      FGVGSAR-------------------------ACPCQVPRASSA--TWV-
A0A2K6NC45_PMAIP1-      -----------------------------------------MPG--KKA-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
A0A2K6QIJ1_BCL2L11      QPSDVSS-------------------------ECDREGRQLQPA--ERP-
                                                                  .       

A0A2K6NC45_PMAIP1-      ----------------------------PARAQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QZT2_BBC3-02      RRHRRPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVAGAQRPGGPG
A0A2K6RAW1_BMF-02       GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVT-----------------
A0A2K6QZT2_BBC3-03      ----------------------------PCQIC-----------------
A0A2K6QK74_BIK-01       DSDM-------------------------LALR-----------------
A0A2K6PUL3_BAD-01       SSSA------------------------ERGLG-----------------
A0A2K6PUL3_BAD-02       SSSA------------------------ERGLG-----------------
A0A2K6RAW1_BMF-01       GPGLRPTSQEDKATQTLGPASPSQGVMLPCGVT-----------------
A0A2K6QZT2_BBC3-01      -PALLPAAYLCAPTAPPAVTAALGGPRWPGGPR-----------------
A0A2K6QZT2_BBC3-04      -PCQICGP--------------------QPSL------------------
A0A2K6NC45_PMAIP1-      -RKNAQPS--------------------PARAQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
A0A2K6QIJ1_BCL2L11      -PQLRPGA--------------------PTSLQ-----------------
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------TEPQA-------------------------------------
A0A2K6QZT2_BBC3-02      GRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATPPL
A0A2K6RAW1_BMF-02       --------EEPQR--------------------------LFYAPAEPKSR
A0A2K6QZT2_BBC3-03      --------ETRGA-------------------------------AATPPL
A0A2K6QK74_BIK-01       --------LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRD
A0A2K6PUL3_BAD-01       --------PSPAGDRPSDSGKHHRQAP-----------GLLWDASHQQEQ
A0A2K6PUL3_BAD-02       --------PSPAGDRPSDSGKHHRQAP-----------GLLWDASHQQEQ
A0A2K6RAW1_BMF-01       --------EEPQR---------LFYGNAGYRLPLPASFPAVL------PI
A0A2K6QZT2_BBC3-01      --------SRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAP
A0A2K6QZT2_BBC3-04      -----------------------SLAEQHLESPVPSAPGALAGGPTQAAP
A0A2K6NC45_PMAIP1-      --------AGPAG----TAGTARDQAGLGIGMQLHFTRGKKLLSSSP---
A0A2K6QIJ1_BCL2L11      --------TEPQ--------------------------------------
A0A2K6QIJ1_BCL2L11      --------TEPQ--------------------------------------
A0A2K6QIJ1_BCL2L11      --------TEPQG----NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      --------TEPQG----NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      --------TEPQG----NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      --------TEPQG----NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      --------TEPQG----NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      --------TEPQG----NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      --------TEPQG----NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
                                                                          

A0A2K6NC45_PMAIP1-      ------------------------------AELEVECATQLRRFGDKLNF
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QZT2_BBC3-02      ALEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDT
A0A2K6RAW1_BMF-02       VVADP------------------------------------PLPAQPCFE
A0A2K6QZT2_BBC3-03      ALEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDT
A0A2K6QK74_BIK-01       VLTSFMDGFTTLKENIMRFW---------------------RSLNPGSQV
A0A2K6PUL3_BAD-01       PTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPPNL
A0A2K6PUL3_BAD-02       PTSSSHHGG--------RAWYYPAESEDSENPSARMLAEASAGMSAPATD
A0A2K6RAW1_BMF-01       GEQPPEGQWQHRAEVQIARKLQCIADQFHR----LHVQQHQQNRNRVWWQ
A0A2K6QZT2_BBC3-01      GVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWRVL
A0A2K6QZT2_BBC3-04      GVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWRVL
A0A2K6NC45_PMAIP1-      ---------------LALPRGHEEQVQVARSRVCYSTQEIWRQTELPAET
A0A2K6QIJ1_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K6QIJ1_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPSPPCQA
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQA
                                                                          

A0A2K6NC45_PMAIP1-      RQKLLNLIAKLFCSGT----------------------------------
A0A2K6QIJ1_BCL2L11      ---------SRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKLLAS
A0A2K6QZT2_BBC3-02      LASAGDFLCTM---------------------------------------
A0A2K6RAW1_BMF-02       WRRE----------------------------------------------
A0A2K6QZT2_BBC3-03      LASAGDFLCTM---------------------------------------
A0A2K6QK74_BIK-01       SREQVLLALLLLLAALLSGGLHLLLK------------------------
A0A2K6PUL3_BAD-01       WAAQRYGRELRRMSDEFVDSFKGLPRP--KSAGTATQMRQSSSWTRVFQS
A0A2K6PUL3_BAD-02       SEAQ--------LAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRSPAP
A0A2K6RAW1_BMF-01       ILLFLHNLALNGEENRNGAGPR----------------------------
A0A2K6QZT2_BBC3-01      YNLIMGLLPLPRGHRAPEMEPN----------------------------
A0A2K6QZT2_BBC3-04      YNLIMGLLPLPRGHRAPEMEPN----------------------------
A0A2K6NC45_PMAIP1-      FESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW-----
A0A2K6QIJ1_BCL2L11      FNHYLSAMVVILED----------IGDTSLWFGFIFTGLDLYVVWIYIYH
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6QIJ1_BCL2L11      FNHYLSAMGIFE--------------------------------------
A0A2K6QIJ1_BCL2L11      FNHYLSAMANWD--------------------------------------
A0A2K6QIJ1_BCL2L11      FNHYLSAMVREIEEVVV---------------------------------
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLEK----
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD-
                                                                          

A0A2K6NC45_PMAIP1-      -------------------------
A0A2K6QIJ1_BCL2L11      ST-----------------------
A0A2K6QZT2_BBC3-02      -------------------------
A0A2K6RAW1_BMF-02       -------------------------
A0A2K6QZT2_BBC3-03      -------------------------
A0A2K6QK74_BIK-01       -------------------------
A0A2K6PUL3_BAD-01       WWDRNLGRGSSAPSQ----------
A0A2K6PUL3_BAD-02       FGAARAPRPLTSGQHSDMAASSGG-
A0A2K6RAW1_BMF-01       -------------------------
A0A2K6QZT2_BBC3-01      -------------------------
A0A2K6QZT2_BBC3-04      -------------------------
A0A2K6NC45_PMAIP1-      -------------------------
A0A2K6QIJ1_BCL2L11      HSQDTEQLNHRDFS-----------
A0A2K6QIJ1_BCL2L11      AAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIJ1_BCL2L11      -------------------------
A0A2K6QIJ1_BCL2L11      -------------------------
A0A2K6QIJ1_BCL2L11      -------------------------
A0A2K6QIJ1_BCL2L11      AAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIJ1_BCL2L11      AAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIJ1_BCL2L11      -------------------------
A0A2K6QIJ1_BCL2L11      -------------------------
                                                 

© 1998-2021Legal notice