Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-03      -------------------------------------IKFGVGSARACPC
A0A2K6QZT2_BBC3-02      -------------------------------------IKFGVGSARACPC
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6QK74_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6PUL3_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K6PUL3_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
                                                                          

A0A2K6NC45_PMAIP1-      --------------------MPGKKARKNAQPSPAR--------------
A0A2K6QZT2_BBC3-03      QVPRASSATWVPCQICETRGAAATPPLALEGPVQSHYGTPALTQGPQSPR
A0A2K6QZT2_BBC3-02      QVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6RAW1_BMF-02       ---------MEPSRCVEELEDD--VFQPEDGEPGAQ---PGSSLSADLFA
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A2K6QZT2_BBC3-01      ---------------MARARQEGSSPEPVEGLARDG---PRPFPLGRLVP
A0A2K6QK74_BIK-01       MEDSDM-LALRLACIGDEMDVSLRAPRLAQLSEVAM---HSLGLAFIYDQ
A0A2K6PUL3_BAD-01       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP--------------GLLWDA
A0A2K6PUL3_BAD-02       EDSSSAERGLGPSPAGDRPSDSGKHHRQAP--------------GLLWDA
A0A2K6RAW1_BMF-01       ---------MEPSRCVEELEDD--VFQPEDGEPGAQ---PGSSLSADLFA
A0A2K6NC45_PMAIP1-      --------------------------MPGKKARKNA---QPSPARAQAGP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
A0A2K6QIJ1_BCL2L11      -------MAKQPSDVSSECDREGRQLQPAERPPQLR---PGAPTSLQTEP
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-03      NGAQLGACTRP---------------------------------------
A0A2K6QZT2_BBC3-02      PGALGSVLRPLRARPGCHPRCPRPAARCLPLRPHRPTRRHRRPGGPPLAW
A0A2K6QIJ1_BCL2L11      Q-------------------------------------------------
A0A2K6RAW1_BMF-02       QSLLDCPLSRL----QLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGV
A0A2K6QZT2_BBC3-04      -------IKFGVGSARACPCQVPRA--SSATWVPCQIC------------
A0A2K6QZT2_BBC3-01      SAVSCGLCEPGLAATPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGGPR
A0A2K6QK74_BIK-01       TDDIRDVLTSF-MDGFTTLKENIMRFW-----------------------
A0A2K6PUL3_BAD-01       SHQQEQPTSSS-HHGGAGAVETRSRHSSYPAGTEEDEGM-----------
A0A2K6PUL3_BAD-02       SHQQEQPTSSS-HHGG--------RAWYYPAESEDSENP-----------
A0A2K6RAW1_BMF-01       QSLLD---CPL-SRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGV
A0A2K6NC45_PMAIP1-      AGTAGTARDQA-GLGIGMQLHFTRGKKLLSSSP-----------------
A0A2K6QIJ1_BCL2L11      Q-------------------------------------------------
A0A2K6QIJ1_BCL2L11      Q-------------------------------------------------
A0A2K6QIJ1_BCL2L11      QGNPED--NHG-GEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIF
A0A2K6QIJ1_BCL2L11      QGNPED--NHG-GEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIF
A0A2K6QIJ1_BCL2L11      QGNPED--NHG-GEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIF
A0A2K6QIJ1_BCL2L11      QGNPED--NHG-GEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIF
A0A2K6QIJ1_BCL2L11      QGNPED--NHG-GEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIF
A0A2K6QIJ1_BCL2L11      QGNPED--NHG-GEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIF
A0A2K6QIJ1_BCL2L11      QGNPED--NHG-GEGDSCPHGSPQGPLAPPASPGPFATR-----SPLFIF
                                                                          

A0A2K6NC45_PMAIP1-      -------------------AQAELEVECATQLRRFGDKLN----------
A0A2K6QZT2_BBC3-03      ---------------VDVRDSGGRPLPPPDTLASAGDFLCTM--------
A0A2K6QZT2_BBC3-02      GSPQPAPRPTPGRSSALALAGGAAPGVAGAQRPGGPGGRSHPGGPGSPRG
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6RAW1_BMF-02       MLPCGVTEEPQRLFYAPAEPKSRVVADPPL-----PAQPC--------FE
A0A2K6QZT2_BBC3-04      ---------GPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQ
A0A2K6QZT2_BBC3-01      SRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQ
A0A2K6QK74_BIK-01       -----------------RSLNPGSQVSREQVLLALLLLLA--------AL
A0A2K6PUL3_BAD-01       --------EEEPSPFRGRSRSAPPNLWAAQRYGRELRRMS--------DE
A0A2K6PUL3_BAD-02       --------SARMLAEASAGMSAPATDSEAQ--------LA--------EN
A0A2K6RAW1_BMF-01       MLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPE--------GQ
A0A2K6NC45_PMAIP1-      ------LALPRGHEEQVQVARSRVCYSTQEIWRQ-TELPA--------ET
A0A2K6QIJ1_BCL2L11      -------------------DRSPAPMSCDKSTQT-PSPPC--------QA
A0A2K6QIJ1_BCL2L11      -------------------DRSPAPMSCDKSTQT-PSPPC--------QA
A0A2K6QIJ1_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPC--------QA
A0A2K6QIJ1_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPC--------QA
A0A2K6QIJ1_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPC--------QA
A0A2K6QIJ1_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPC--------QA
A0A2K6QIJ1_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPC--------QA
A0A2K6QIJ1_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPC--------QA
A0A2K6QIJ1_BCL2L11      MRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQT-PSPPC--------QA
                                                                          

A0A2K6NC45_PMAIP1-      FRQKLLNLIAKLFCSGT---------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-02      GGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATPPLALEGPVQSHYGTP
A0A2K6QIJ1_BCL2L11      --------ASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKLLAS
A0A2K6RAW1_BMF-02       WRRE----------------------------------------------
A0A2K6QZT2_BBC3-04      WAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLP
A0A2K6QZT2_BBC3-01      WAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLP
A0A2K6QK74_BIK-01       LSGGLHLLLK----------------------------------------
A0A2K6PUL3_BAD-01       FVDSFKGLPRP--KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ-
A0A2K6PUL3_BAD-02       VKLEALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHS
A0A2K6RAW1_BMF-01       WQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNG
A0A2K6NC45_PMAIP1-      FESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW-----
A0A2K6QIJ1_BCL2L11      FNHYLSAMVVILED----------IGDTSLWFGFIFTGLDLYVVWIYIYH
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6QIJ1_BCL2L11      FNHYLSAMVREIEEVVV---------------------------------
A0A2K6QIJ1_BCL2L11      FNHYLSAMANWD--------------------------------------
A0A2K6QIJ1_BCL2L11      FNHYLSAMGIFE--------------------------------------
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQ
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLEK----
A0A2K6QIJ1_BCL2L11      FNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD-
                                                                          

A0A2K6NC45_PMAIP1-      ------------------------------------------------
A0A2K6QZT2_BBC3-03      ------------------------------------------------
A0A2K6QZT2_BBC3-02      ALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM
A0A2K6QIJ1_BCL2L11      ST----------------------------------------------
A0A2K6RAW1_BMF-02       ------------------------------------------------
A0A2K6QZT2_BBC3-04      RGHRAPEMEPN-------------------------------------
A0A2K6QZT2_BBC3-01      RGHRAPEMEPN-------------------------------------
A0A2K6QK74_BIK-01       ------------------------------------------------
A0A2K6PUL3_BAD-01       ------------------------------------------------
A0A2K6PUL3_BAD-02       DMAASSGG----------------------------------------
A0A2K6RAW1_BMF-01       EENRNGAGPR--------------------------------------
A0A2K6NC45_PMAIP1-      ------------------------------------------------
A0A2K6QIJ1_BCL2L11      HSQDTEQLNHRDFS----------------------------------
A0A2K6QIJ1_BCL2L11      AAEEHPQMVILRLLRYIVRLVWRMH-----------------------
A0A2K6QIJ1_BCL2L11      ------------------------------------------------
A0A2K6QIJ1_BCL2L11      ------------------------------------------------
A0A2K6QIJ1_BCL2L11      ------------------------------------------------
A0A2K6QIJ1_BCL2L11      AAEEHPQMVILRLLRYIVRLVWRMH-----------------------
A0A2K6QIJ1_BCL2L11      AAEEHPQMVILRLLRYIVRLVWRMH-----------------------
A0A2K6QIJ1_BCL2L11      ------------------------------------------------
A0A2K6QIJ1_BCL2L11      ------------------------------------------------
                                                                        

© 1998-2021Legal notice