Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-02      ------------------------IKFGVGSARACPCQVPRASSATWVPC
A0A2K6RAW1_BMF-02       --------------------------------MEPSRCVEELEDDV----
A0A2K6RAW1_BMF-01       --------------------------------MEPSRCVEELEDDV----
A0A2K6QZT2_BBC3-03      ------------------------------------IKFGVGSARACPCQ
A0A2K6QZT2_BBC3-01      ----------------------MARARQEGSSPEPVEGLARDGPRPFPLG
A0A2K6QZT2_BBC3-04      --IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLSLAEQHLES----
A0A2K6QK74_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6PUL3_BAD-02       ------------------------------MFQIPEFEPSEQEDSS----
A0A2K6PUL3_BAD-01       ------------------------------MFQIPEFEPSEQEDSS----
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
A0A2K6QIL2_BCL2L11      ------------------------------MAKQPS-DVSSECDRE----
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-02      QICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRA
A0A2K6RAW1_BMF-02       -----------------F--------------------------------
A0A2K6RAW1_BMF-01       -----------------F--------------------------------
A0A2K6QZT2_BBC3-03      VPRASSATWVPCQICETR--------------------------------
A0A2K6QZT2_BBC3-01      RLVPSAVSCGLCEPGLAA--------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A2K6QK74_BIK-01       MEDSDMLALRLACIGDEM--------------------------------
A0A2K6PUL3_BAD-02       --------------SAER--------------------------------
A0A2K6PUL3_BAD-01       --------------SAER--------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
A0A2K6QIL2_BCL2L11      --------------GRQL--------------------------------
                                                                          

A0A2K6NC45_PMAIP1-      ----------------------------------------MPGKKA----
A0A2K6QZT2_BBC3-02      RPGCHPRCPRPAARCLPLRPHRPTRRHRRPGGPPLAWGSPQPAPRPTPGR
A0A2K6RAW1_BMF-02       ----------------------------------------QPEDGE----
A0A2K6RAW1_BMF-01       ----------------------------------------QPEDGE----
A0A2K6QZT2_BBC3-03      ----------------------------------------GAAATP----
A0A2K6QZT2_BBC3-01      ----------------------------------------TPAAPALLPA
A0A2K6QZT2_BBC3-04      -----------------------------------------PVPSA----
A0A2K6QK74_BIK-01       ----------------------------------------DVSLRA----
A0A2K6PUL3_BAD-02       ----------------------------------------GLGPSP----
A0A2K6PUL3_BAD-01       ----------------------------------------GLGPSP----
A0A2K6NC45_PMAIP1-      ----------------------------------------MPGKKA----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
A0A2K6QIL2_BCL2L11      ----------------------------------------QPAERP----
                                                                          

A0A2K6NC45_PMAIP1-      ------------------------RKNAQPSPARAQAELE----------
A0A2K6QZT2_BBC3-02      SSALALAGGAAPGVAGAQRPGGPGGRSHPGGPGSPRGGGTVGPGDRGPAA
A0A2K6RAW1_BMF-02       ------------------------PGAQPGSSLSADLFAQSLLDC-----
A0A2K6RAW1_BMF-01       ------------------------PGAQPGSSLSADLFAQSLLDC-----
A0A2K6QZT2_BBC3-03      ------------------------PLALEGPVQSHYGTPALTQGPQSPRN
A0A2K6QZT2_BBC3-01      AYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLAE-----
A0A2K6QZT2_BBC3-04      ------------------------PGALAGGPTQAAPGVRGEEEQ-----
A0A2K6QK74_BIK-01       ------------------------PRLAQLSEVAMHSLGLAFIYD-----
A0A2K6PUL3_BAD-02       ------------------------AGDRPSDSGKHHRQAPGLLWDASHQQ
A0A2K6PUL3_BAD-01       ------------------------AGDRPSDSGKHHRQAPGLLWDASHQQ
A0A2K6NC45_PMAIP1-      ------------------------RKNAQPSPARAQAGPAGTAGTARDQA
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQ----------
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQ----------
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQ----------
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQGNPED--NHG
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQGNPED--NHG
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQGNPED--NHG
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQGNPED--NHG
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQGNPED--NHG
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQGNPED--NHG
A0A2K6QIL2_BCL2L11      ------------------------PQLRPGAPTSLQTEPQGNPED--NHG
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-02      ADGGRPQRAVRAAETRGAAATPPLALEGPVQSHYGTPALTQGPQSPRNGA
A0A2K6RAW1_BMF-02       -------------------------PLSRLQLFPLTHCCGPGLRPTSQED
A0A2K6RAW1_BMF-01       -------------------------PLSRLQLFPLTHCCGPGLRPTSQED
A0A2K6QZT2_BBC3-03      GA------------------------------------------------
A0A2K6QZT2_BBC3-01      -QHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2K6QZT2_BBC3-04      --------------------------------WAREIGAQLRRMADDLNA
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A2K6PUL3_BAD-02       EQPTSSSHHGG--------RAWYYPAESE---------------------
A0A2K6PUL3_BAD-01       EQPTSSSHHGGAGAVETRSRHSSYPAGTE---------------------
A0A2K6NC45_PMAIP1-      GLGIGMQLHFTRGKKLLSSSP------------------LALPRGHEEQV
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
A0A2K6QIL2_BCL2L11      GEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSF
                                                                          

A0A2K6NC45_PMAIP1-      --------VECATQLRRFGDKLNFRQKLLNLIAKLFCSGT----------
A0A2K6QZT2_BBC3-02      QLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM---------------
A0A2K6RAW1_BMF-02       KATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL-----
A0A2K6RAW1_BMF-01       KATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIG
A0A2K6QZT2_BBC3-03      QLGACTRPVDVRDSGGRPLPPPDTLASAGDFLCTM---------------
A0A2K6QZT2_BBC3-01      QYERRRQE---EQQRHRPSPWRVLYNLIMGLLPLPRGH------------
A0A2K6QZT2_BBC3-04      QYERRRQE---EQQRHRPSPWRVLYNLIMGLLPLPRGH------------
A0A2K6QK74_BIK-01       ---------QTDDIRDVLTSFMDGFTTLKENIMRFWRS------------
A0A2K6PUL3_BAD-02       DSENPSARMLAEASAGMSAPATDSEAQ--------LAENVKLEALGLWRP
A0A2K6PUL3_BAD-01       EDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRP
A0A2K6NC45_PMAIP1-      QVARSRVCYSTQEIWRQTELPAETFESDSQTLLLRNLT------------
A0A2K6QIL2_BCL2L11      --------------------------------ASRRQA------------
A0A2K6QIL2_BCL2L11      --DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILED------------
A0A2K6QIL2_BCL2L11      --DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQA------------
A0A2K6QIL2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQA------------
A0A2K6QIL2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQA------------
A0A2K6QIL2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQA------------
A0A2K6QIL2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQA------------
A0A2K6QIL2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEE------------
A0A2K6QIL2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE--------------
A0A2K6QIL2_BCL2L11      DTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD--------------
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-02      --------------------------------------------------
A0A2K6RAW1_BMF-02       --PAQPCFEWRRE-------------------------------------
A0A2K6RAW1_BMF-01       EQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFL
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --RAPEMEPN----------------------------------------
A0A2K6QZT2_BBC3-04      --RAPEMEPN----------------------------------------
A0A2K6QK74_BIK-01       -LNPGSQVSREQVLLALLLLLAALLSGGLHLLLK----------------
A0A2K6PUL3_BAD-02       GVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG---
A0A2K6PUL3_BAD-01       --KSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ------------
A0A2K6NC45_PMAIP1-      --ASKTCIRGLQTRIFLRRC--TFHQFEERLHCNW---------------
A0A2K6QIL2_BCL2L11      --EPADMRPEIRIAQELRRIGDEFNAYYARRLAKLLASST----------
A0A2K6QIL2_BCL2L11      ------------IGDTSLWFGFIFTGLDLYVVWIYIYHHSQDTEQLNHRD
A0A2K6QIL2_BCL2L11      --EPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEEHPQMVILR
A0A2K6QIL2_BCL2L11      --EPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEEHPQMVILR
A0A2K6QIL2_BCL2L11      --EPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNYQAAEEHPQMVILR
A0A2K6QIL2_BCL2L11      --EPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD-------------
A0A2K6QIL2_BCL2L11      --EPADMRPEIRIAQELRRIGDEFNAYYARRLEK----------------
A0A2K6QIL2_BCL2L11      --VVV---------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
A0A2K6QIL2_BCL2L11      --------------------------------------------------
                                                                          

A0A2K6NC45_PMAIP1-      -----------------
A0A2K6QZT2_BBC3-02      -----------------
A0A2K6RAW1_BMF-02       -----------------
A0A2K6RAW1_BMF-01       HNLALNGEENRNGAGPR
A0A2K6QZT2_BBC3-03      -----------------
A0A2K6QZT2_BBC3-01      -----------------
A0A2K6QZT2_BBC3-04      -----------------
A0A2K6QK74_BIK-01       -----------------
A0A2K6PUL3_BAD-02       -----------------
A0A2K6PUL3_BAD-01       -----------------
A0A2K6NC45_PMAIP1-      -----------------
A0A2K6QIL2_BCL2L11      -----------------
A0A2K6QIL2_BCL2L11      FS---------------
A0A2K6QIL2_BCL2L11      LLRYIVRLVWRMH----
A0A2K6QIL2_BCL2L11      LLRYIVRLVWRMH----
A0A2K6QIL2_BCL2L11      LLRYIVRLVWRMH----
A0A2K6QIL2_BCL2L11      -----------------
A0A2K6QIL2_BCL2L11      -----------------
A0A2K6QIL2_BCL2L11      -----------------
A0A2K6QIL2_BCL2L11      -----------------
A0A2K6QIL2_BCL2L11      -----------------
                                         

© 1998-2020Legal notice