Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      ---------------------------------------------MPGKK
A0A2K6QZT2_BBC3-02      --IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPR-----TPGGQ
A0A2K6RAW1_BMF-02       ------------------MEPSRCVEELEDDVF------------QPEDG
A0A2K6QK74_BIK-01       MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLEC
A0A2K6PUL3_BAD-02       --------------------------------------MFQIPEFEPSEQ
A0A2K6PUL3_BAD-01       --------------------------------------MFQIPEFEPSEQ
A0A2K6QZT2_BBC3-03      --IKFGVGSARACPCQVPRASSATWVPCQICETR-----------GAAAT
A0A2K6RAW1_BMF-01       ------------------MEPSRCVEELEDDVF------------QPEDG
A0A2K6QZT2_BBC3-01      ----------------MARARQEGSSPEPVEGLA-----------RDGPR
A0A2K6QZT2_BBC3-04      --IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLSLAEQHLESPVPS
A0A2K6NC45_PMAIP1-      ---------------------------------------------MPGKK
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
A0A2K6QIJ1_BCL2L11      ----------------MAKQPSDVSSECDREGRQL----------QPAER
                                                                          

A0A2K6NC45_PMAIP1-      ARKNA---------------------------------------------
A0A2K6QZT2_BBC3-02      LPGARRGPG-----------------------------------------
A0A2K6RAW1_BMF-02       EPGAQ---------------------------------------------
A0A2K6QK74_BIK-01       MED-----------------------------------------------
A0A2K6PUL3_BAD-02       EDS-----------------------------------------------
A0A2K6PUL3_BAD-01       EDS-----------------------------------------------
A0A2K6QZT2_BBC3-03      PPLAL---------------------------------------------
A0A2K6RAW1_BMF-01       EPGAQ---------------------------------------------
A0A2K6QZT2_BBC3-01      PFPLGRLVPSAVSCGLCEPGLAATPAAPALLPAAYLCAPTAPPAVTAALG
A0A2K6QZT2_BBC3-04      APGAL---------------------------------------------
A0A2K6NC45_PMAIP1-      ARKNA---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
A0A2K6QIJ1_BCL2L11      PPQLR---------------------------------------------
                                                                          

A0A2K6NC45_PMAIP1-      ----QPSPARAQAELEVECATQLRRFGDKLN-------------------
A0A2K6QZT2_BBC3-02      ----PRRPAPLPARPPGALGSVLRPLRARPGCHPRCPRPAARCLPLRPHR
A0A2K6RAW1_BMF-02       ----PGSSLSADLFAQSLL---------------DCPLSRLQLFPLTHCC
A0A2K6QK74_BIK-01       ----SDM-LALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTD
A0A2K6PUL3_BAD-02       ----SSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASH
A0A2K6PUL3_BAD-01       ----SSAERGLGPSPAGDRPSDSGKHHRQAP-----------GLLWDASH
A0A2K6QZT2_BBC3-03      ----EGPVQSHYGTPALTQGPQSPRNGAQLG---AC--------------
A0A2K6RAW1_BMF-01       ----PGSSLSADLFAQSL------------L---DCPLSRLQLFPLTHCC
A0A2K6QZT2_BBC3-01      GPRWPGGPRSRPRGPRPDGPQPSLSLAEQHL---ESPVPSAPGALAGGPT
A0A2K6QZT2_BBC3-04      ----AGGPTQAAPGVRGE-EEQ----------------------------
A0A2K6NC45_PMAIP1-      ----QPSPARAQAGPAGT-AGTARDQAGLGI---GMQLHFTRGKKLLSSS
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQ----------------------------------
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQ----------------------------------
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQ----------------------------------
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQGN-PED--NHGGEGD---SCPHGSPQGPLAPPAS
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQGN-PED--NHGGEGD---SCPHGSPQGPLAPPAS
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQGN-PED--NHGGEGD---SCPHGSPQGPLAPPAS
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQGN-PED--NHGGEGD---SCPHGSPQGPLAPPAS
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQGN-PED--NHGGEGD---SCPHGSPQGPLAPPAS
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQGN-PED--NHGGEGD---SCPHGSPQGPLAPPAS
A0A2K6QIJ1_BCL2L11      ----PGAPTSLQTEPQGN-PED--NHGGEGD---SCPHGSPQGPLAPPAS
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-02      PTRRHRRPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVAGAQRPGG
A0A2K6RAW1_BMF-02       G-------------------------------------------------
A0A2K6QK74_BIK-01       D-------------------------------------------------
A0A2K6PUL3_BAD-02       Q-------------------------------------------------
A0A2K6PUL3_BAD-01       Q-------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6RAW1_BMF-01       G-------------------------------------------------
A0A2K6QZT2_BBC3-01      Q-------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A2K6NC45_PMAIP1-      P-------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      P-------------------------------------------------
A0A2K6QIJ1_BCL2L11      P-------------------------------------------------
A0A2K6QIJ1_BCL2L11      P-------------------------------------------------
A0A2K6QIJ1_BCL2L11      P-------------------------------------------------
A0A2K6QIJ1_BCL2L11      P-------------------------------------------------
A0A2K6QIJ1_BCL2L11      P-------------------------------------------------
A0A2K6QIJ1_BCL2L11      P-------------------------------------------------
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-02      PGGRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATP
A0A2K6RAW1_BMF-02       -------------------------------------------------P
A0A2K6QK74_BIK-01       -------------------------------------------------I
A0A2K6PUL3_BAD-02       -------------------------------------------------Q
A0A2K6PUL3_BAD-01       -------------------------------------------------Q
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6RAW1_BMF-01       -------------------------------------------------P
A0A2K6QZT2_BBC3-01      -------------------------------------------------A
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      -------------------------------------------------G
A0A2K6QIJ1_BCL2L11      -------------------------------------------------G
A0A2K6QIJ1_BCL2L11      -------------------------------------------------G
A0A2K6QIJ1_BCL2L11      -------------------------------------------------G
A0A2K6QIJ1_BCL2L11      -------------------------------------------------G
A0A2K6QIJ1_BCL2L11      -------------------------------------------------G
A0A2K6QIJ1_BCL2L11      -------------------------------------------------G
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-02      PLALEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPP
A0A2K6RAW1_BMF-02       GLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVA
A0A2K6QK74_BIK-01       RDVLTSFMDGFTTLKENIMRFW---------------------RSLNPGS
A0A2K6PUL3_BAD-02       EQPTSSSHHGG--------RAWYYPAESEDSENPSARMLAEASAGMSAPA
A0A2K6PUL3_BAD-01       EQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSAPP
A0A2K6QZT2_BBC3-03      ---------------------------------TRPVDVRDSGGRPLPPP
A0A2K6RAW1_BMF-01       GLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPA
A0A2K6QZT2_BBC3-01      APGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWR
A0A2K6QZT2_BBC3-04      ----------WAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPSPWR
A0A2K6NC45_PMAIP1-      -----------------LALPRGHEEQVQVARSRVCYSTQEIWRQTELPA
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      ------------------------------DRSPAPMSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      ------------------------------DRSPAPMSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      PFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      PFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      PFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      PFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      PFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      PFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
A0A2K6QIJ1_BCL2L11      PFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPC
                                                                          

A0A2K6NC45_PMAIP1-      --FRQKLLNLIAKLFCSGT-------------------------------
A0A2K6QZT2_BBC3-02      DTLASAGDFLCTM-------------------------------------
A0A2K6RAW1_BMF-02       DPPLPAQPCFEWRRE-----------------------------------
A0A2K6QK74_BIK-01       QVSREQVLLALLLLLAALLSGGLHLLLK----------------------
A0A2K6PUL3_BAD-02       TDSEAQ--------LAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRSP
A0A2K6PUL3_BAD-01       NLWAAQRYGRELRRMSDEFVDSFKGLPRP--KSAGTATQMRQSSSWTRVF
A0A2K6QZT2_BBC3-03      DTLASAGDFLCTM-------------------------------------
A0A2K6RAW1_BMF-01       SF--PAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNR
A0A2K6QZT2_BBC3-01      VLYNLIMGLLPLPRGHRAPEMEPN--------------------------
A0A2K6QZT2_BBC3-04      VLYNLIMGLLPLPRGHRAPEMEPN--------------------------
A0A2K6NC45_PMAIP1-      ETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRC--TFHQFEERLHCNW-
A0A2K6QIJ1_BCL2L11      ----------ASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKLL
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMVVILED----------IGDTSLWFGFIFTGLDLYVVWIYI
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNN
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMVREIEEVVV-------------------------------
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMANWD------------------------------------
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMGIFE------------------------------------
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNN
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNN
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPP
A0A2K6QIJ1_BCL2L11      QAFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLEK--
                                                                          

A0A2K6NC45_PMAIP1-      ----------------------------
A0A2K6QZT2_BBC3-02      ----------------------------
A0A2K6RAW1_BMF-02       ----------------------------
A0A2K6QK74_BIK-01       ----------------------------
A0A2K6PUL3_BAD-02       APFGAARAPRPLTSGQHSDMAASSGG--
A0A2K6PUL3_BAD-01       QSWWDRNLGRGSSAPSQ-----------
A0A2K6QZT2_BBC3-03      ----------------------------
A0A2K6RAW1_BMF-01       NRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6QZT2_BBC3-01      ----------------------------
A0A2K6QZT2_BBC3-04      ----------------------------
A0A2K6NC45_PMAIP1-      ----------------------------
A0A2K6QIJ1_BCL2L11      ASST------------------------
A0A2K6QIJ1_BCL2L11      YHHSQDTEQLNHRDFS------------
A0A2K6QIJ1_BCL2L11      YQAAEEHPQMVILRLLRYIVRLVWRMH-
A0A2K6QIJ1_BCL2L11      ----------------------------
A0A2K6QIJ1_BCL2L11      ----------------------------
A0A2K6QIJ1_BCL2L11      ----------------------------
A0A2K6QIJ1_BCL2L11      YQAAEEHPQMVILRLLRYIVRLVWRMH-
A0A2K6QIJ1_BCL2L11      YQAAEEHPQMVILRLLRYIVRLVWRMH-
A0A2K6QIJ1_BCL2L11      D---------------------------
A0A2K6QIJ1_BCL2L11      ----------------------------
                                                    

© 1998-2021Legal notice