Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

21 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-02      IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRG
A0A2K6QK74_BIK-01       ----------------------------------MSGVRPVSRDILMETL
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A2K6QZT2_BBC3-01      --------------------------------------------------
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-02      PGPRRPAPLPARPPGALGSVLRPLRARPGCHPRCPRPAARCLPLRPHRPT
A0A2K6QK74_BIK-01       LYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDM-LALRLACIG
A0A2K6PUL3_BAD-02       ----------------------MFQIPEFEPSEQEDSSSAERGLGPSPAG
A0A2K6PUL3_BAD-01       ----------------------MFQIPEFEPSEQEDSSSAERGLGPSPAG
A0A2K6RAW1_BMF-02       ------------------------MEPSRCVEELEDDV------------
A0A2K6RAW1_BMF-01       ------------------------MEPSRCVEELEDDV------------
A0A2K6QZT2_BBC3-04      --------------------------------------------------
A0A2K6QZT2_BBC3-01      ----------------------MARARQEGSSPEPVEGLARDGPRPFPLG
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
A0A2K6QIJ1_BCL2L11      ----------------------MAKQPSDVSSECDREGRQ----------
                                                                          

A0A2K6NC45_PMAIP1-      ----------------MPGKKARKNAQPSPA-------------------
A0A2K6QZT2_BBC3-03      -----------IKFGVGSARACPCQVPRASSATWVPCQI-----------
A0A2K6QZT2_BBC3-02      RRHRRPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVAGAQRPGGPG
A0A2K6QK74_BIK-01       DE-------------MDVSLRAPRLAQLSEVAMHSLGLAFIYDQ----TD
A0A2K6PUL3_BAD-02       DR-------------PSDSGKHHRQAP-----------GLLWDA----SH
A0A2K6PUL3_BAD-01       DR-------------PSDSGKHHRQAP-----------GLLWDA----SH
A0A2K6RAW1_BMF-02       ---------------FQPEDGEPGAQPGSSLSADLFAQSLLD--------
A0A2K6RAW1_BMF-01       ---------------FQPEDGEPGAQPGSSLSADLFAQSLLD--------
A0A2K6QZT2_BBC3-04      -----------IKFGVGSARACPCQVPRA--SSATWVPCQIC--------
A0A2K6QZT2_BBC3-01      RLVPSAVSCGLCEPGLAATPAAPALLPAAYLCAPTAPPAVTAAL----GG
A0A2K6NC45_PMAIP1-      ----------------MPGKKARKNAQPSPARAQAGPAG-----------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQ------------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQ------------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQ------------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQG-----------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQG-----------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQG-----------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQG-----------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQG-----------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQG-----------
A0A2K6QIJ1_BCL2L11      ---------------LQPAERPPQLRPGAPTSLQTEPQG-----------
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QZT2_BBC3-03      --------------------------------------CETRGAAATPPL
A0A2K6QZT2_BBC3-02      GRSHPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATPPL
A0A2K6QK74_BIK-01       DIRDVLTSFMDGFTTLKENIMRFW---------------------RSLNP
A0A2K6PUL3_BAD-02       QQEQPTSSSHHGG--------RAWYYPAESEDSENPSARMLAEASAGMSA
A0A2K6PUL3_BAD-01       QQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGMEEEPSPFRGRSRSA
A0A2K6RAW1_BMF-02       -----------------CPLSRLQLFPLTHCCGPGLRPTSQEDKATQ-TL
A0A2K6RAW1_BMF-01       -----------------CPLSRLQLFPLTHCCGPGLRPTSQEDKATQ-TL
A0A2K6QZT2_BBC3-04      -----------------GPQPSLSLAEQHLESPVPSAPGALAGGPTQAAP
A0A2K6QZT2_BBC3-01      PRWPGGPRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAP
A0A2K6NC45_PMAIP1-      -----------------TAGTARDQAGLGIGMQLHFTRGKKLLSSSP---
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      -----------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      -----------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      -----------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      -----------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      -----------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      -----------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
A0A2K6QIJ1_BCL2L11      -----------------NPED--NHGGEGDSCPHGSPQGPLAPPASPGPF
                                                                          

A0A2K6NC45_PMAIP1-      -----------------------------RAQAELEVECATQLRRFGDKL
A0A2K6QZT2_BBC3-03      ALEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPL-PPPD
A0A2K6QZT2_BBC3-02      ALEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPL-PPPD
A0A2K6QK74_BIK-01       GSQVSREQVLLALLLLLAALLSGGLHLLLK--------------------
A0A2K6PUL3_BAD-02       PATDSEAQ--------LAENVKLEALGLWRPGVATAPTPRGRRRTKGWRR
A0A2K6PUL3_BAD-01       PPNLWAAQRYGRELRRMSDEFVDSFKGLPRP--KSAGTATQMRQSSSWTR
A0A2K6RAW1_BMF-02       GPASPSQGVMLPCGVTEEPQRLFYAPAEPKSRVVADPPL-------PAQP
A0A2K6RAW1_BMF-01       GPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEG
A0A2K6QZT2_BBC3-04      GVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPS-PWRV
A0A2K6QZT2_BBC3-01      GVRGEEEQWAREIGAQLRRMADDLNAQYERRRQE---EQQRHRPS-PWRV
A0A2K6NC45_PMAIP1-      ---------------LALPRGHEEQVQVARSRVCYSTQEIWRQTE-LPAE
A0A2K6QIJ1_BCL2L11      --------------------------------------------------
A0A2K6QIJ1_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPS-PPCQ
A0A2K6QIJ1_BCL2L11      ----------------------------DRSPAPMSCDKSTQTPS-PPCQ
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS-PPCQ
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS-PPCQ
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS-PPCQ
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS-PPCQ
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS-PPCQ
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS-PPCQ
A0A2K6QIJ1_BCL2L11      ATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPS-PPCQ
                                                                          

A0A2K6NC45_PMAIP1-      NFRQKLLNLIAKLFCSGT--------------------------------
A0A2K6QZT2_BBC3-03      TLASAGDFLCTM--------------------------------------
A0A2K6QZT2_BBC3-02      TLASAGDFLCTM--------------------------------------
A0A2K6QK74_BIK-01       --------------------------------------------------
A0A2K6PUL3_BAD-02       SPAPFGAARAPRPLTSGQHSDMAASSGG----------------------
A0A2K6PUL3_BAD-01       VFQSWWDRNLGRGSSAPSQ-------------------------------
A0A2K6RAW1_BMF-02       CFEWRRE-------------------------------------------
A0A2K6RAW1_BMF-01       QWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALN
A0A2K6QZT2_BBC3-04      LYNLIMGLLPLPRGHRAPEMEPN---------------------------
A0A2K6QZT2_BBC3-01      LYNLIMGLLPLPRGHRAPEMEPN---------------------------
A0A2K6NC45_PMAIP1-      TFESDSQTLLLRNLTASKTCIRGLQTRIFLRRC--TFHQFEERLHCNW--
A0A2K6QIJ1_BCL2L11      ---------ASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLAKLLA
A0A2K6QIJ1_BCL2L11      AFNHYLSAMVVILED----------IGDTSLWFGFIFTGLDLYVVWIYIY
A0A2K6QIJ1_BCL2L11      AFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNY
A0A2K6QIJ1_BCL2L11      AFNHYLSAMVREIEEVVV--------------------------------
A0A2K6QIJ1_BCL2L11      AFNHYLSAMGIFE-------------------------------------
A0A2K6QIJ1_BCL2L11      AFNHYLSAMANWD-------------------------------------
A0A2K6QIJ1_BCL2L11      AFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNY
A0A2K6QIJ1_BCL2L11      AFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRVFLNNY
A0A2K6QIJ1_BCL2L11      AFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRLEK---
A0A2K6QIJ1_BCL2L11      AFNHYLSAMASRRQAEPADMRPEIRIAQELRRIGDEFNAYYARRMSLPPD
                                                                          

A0A2K6NC45_PMAIP1-      --------------------------
A0A2K6QZT2_BBC3-03      --------------------------
A0A2K6QZT2_BBC3-02      --------------------------
A0A2K6QK74_BIK-01       --------------------------
A0A2K6PUL3_BAD-02       --------------------------
A0A2K6PUL3_BAD-01       --------------------------
A0A2K6RAW1_BMF-02       --------------------------
A0A2K6RAW1_BMF-01       GEENRNGAGPR---------------
A0A2K6QZT2_BBC3-04      --------------------------
A0A2K6QZT2_BBC3-01      --------------------------
A0A2K6NC45_PMAIP1-      --------------------------
A0A2K6QIJ1_BCL2L11      SST-----------------------
A0A2K6QIJ1_BCL2L11      HHSQDTEQLNHRDFS-----------
A0A2K6QIJ1_BCL2L11      QAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIJ1_BCL2L11      --------------------------
A0A2K6QIJ1_BCL2L11      --------------------------
A0A2K6QIJ1_BCL2L11      --------------------------
A0A2K6QIJ1_BCL2L11      QAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIJ1_BCL2L11      QAAEEHPQMVILRLLRYIVRLVWRMH
A0A2K6QIJ1_BCL2L11      --------------------------
A0A2K6QIJ1_BCL2L11      --------------------------
                                                  

© 1998-2022Legal notice