Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6RAW1_BMF-02       --------------------------------------------------
A0A2K6RAW1_BMF-01       --------------------------------------------------
A0A2K6QZT2_BBC3-04      ---------------------------------------IKFGVGSARAC
A0A2K6QZT2_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAA
A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6QIL2_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2K6QIL2_BCL2L11      ------------------------------------MAKQPSDVSSECDR
A0A2K6QK74_BIK-01       --------------MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPE
A0A2K6PUL3_BAD-02       --------------------------------------------------
A0A2K6PUL3_BAD-01       --------------------------------------------------
                                                                          

A0A2K6NC45_PMAIP1-      -----MPGKKARKNAQPSPARAQAEL------------------------
A0A2K6RAW1_BMF-02       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6RAW1_BMF-01       -------MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCP
A0A2K6QZT2_BBC3-04      PCQVPRA--SSATWVPCQIC---------------------GPQPSLSLA
A0A2K6QZT2_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSRPRGPRPDGPQPSLSLA
A0A2K6NC45_PMAIP1-      -----MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFTRG
A0A2K6QIL2_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSPQG
A0A2K6QIL2_BCL2L11      EGRQLQPAERPPQLRPGAPTSLQTEPQGNPED--NHGGEGDSCPHGSPQG
A0A2K6QK74_BIK-01       EDLDPMEDFDPLECMEDSDM-LALRLACIGDEMDVSLRAPRLAQLSEVAM
A0A2K6PUL3_BAD-02       --MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAP------
A0A2K6PUL3_BAD-01       --MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAP------
                                  .                                       

A0A2K6NC45_PMAIP1-      --------------------------------------------------
A0A2K6RAW1_BMF-02       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQ
A0A2K6RAW1_BMF-01       LSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQGVMLPCGVTEEPQ
A0A2K6QZT2_BBC3-04      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2K6QZT2_BBC3-01      EQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNA
A0A2K6NC45_PMAIP1-      KKLLSSSPLALPRGHEEQVQVARSRVCYSTQEIWRQTELPAETFESDSQT
A0A2K6QIL2_BCL2L11      -------PLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6QIL2_BCL2L11      -------PLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSP
A0A2K6QK74_BIK-01       HSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFW-------------
A0A2K6PUL3_BAD-02       -----GLLWDASHQQEQPTSSSHHGG--------RAWYYPAESEDSENPS
A0A2K6PUL3_BAD-01       -----GLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGTEEDEGME
                                                                          

A0A2K6NC45_PMAIP1-      -----EVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT------------
A0A2K6RAW1_BMF-02       RLFYAPAEPKSRVVADPPL-------PAQPCFEWRRE-------------
A0A2K6RAW1_BMF-01       RLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQ
A0A2K6QZT2_BBC3-04      QYERRRQEEQQRHRPSPWRVLY----------NLIMGLLPLPRGHRAPEM
A0A2K6QZT2_BBC3-01      QYERRRQEEQQRHRPSPWRVLY----------NLIMGLLPLPRGHRAPEM
A0A2K6NC45_PMAIP1-      LLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW------------
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAM-----GIFE---------------
A0A2K6QIL2_BCL2L11      APMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV---------------
A0A2K6QK74_BIK-01       --------RSLNPGSQVSREQVLLALLLLLAALLSGGLHLLLK-------
A0A2K6PUL3_BAD-02       ARMLAEASAGMSAPATDSEAQ--------LAENVKLEALGLWRPGVATAP
A0A2K6PUL3_BAD-01       EEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRP--KSAG
                                                                          

A0A2K6NC45_PMAIP1-      -----------------------------------------
A0A2K6RAW1_BMF-02       -----------------------------------------
A0A2K6RAW1_BMF-01       FHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNGAGPR
A0A2K6QZT2_BBC3-04      EPN--------------------------------------
A0A2K6QZT2_BBC3-01      EPN--------------------------------------
A0A2K6NC45_PMAIP1-      -----------------------------------------
A0A2K6QIL2_BCL2L11      -----------------------------------------
A0A2K6QIL2_BCL2L11      -----------------------------------------
A0A2K6QK74_BIK-01       -----------------------------------------
A0A2K6PUL3_BAD-02       TPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASSGG
A0A2K6PUL3_BAD-01       TATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ---------
                                                                 

© 1998-2020Legal notice