Dataset for protein classical BH3-containing proteins of organism Rhinopithecus roxellana

[Download (right click)] [Alignment] [Repertoires]

11 sequence(s)

>gnl|bcl2dbpro|A0A2K6NC45_PMAIP1-02 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=PMAIP1 (length=133 residues).
MPGKKARKNAQPSPARAQAGPAGTAGTARDQAGLGIGMQLHFTRGKKLLSSSPLALPRGHEEQVQVARSRVCYSTQEIWR
QTELPAETFESDSQTLLLRNLTASKTCIRGLQTRIFLRRCTFHQFEERLHCNW
>gnl|bcl2dbpro|A0A2K6NC45_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinopithecus roxellana GN=PMAIP1 (length=54 residues).
MPGKKARKNAQPSPARAQAELEVECATQLRRFGDKLNFRQKLLNLIAKLFCSGT
>gnl|bcl2dbpro|A0A2K6PUL3_BAD-02 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rhinopithecus roxellana GN=BAD (length=162 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGRAWYYPAESEDSENPSA
RMLAEASAGMSAPATDSEAQLAENVKLEALGLWRPGVATAPTPRGRRRTKGWRRSPAPFGAARAPRPLTSGQHSDMAASS
GG
>gnl|bcl2dbpro|A0A2K6PUL3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rhinopithecus roxellana GN=BAD (length=167 residues).
MFQIPEFEPSEQEDSSSAERGLGPSPAGDRPSDSGKHHRQAPGLLWDASHQQEQPTSSSHHGGAGAVETRSRHSSYPAGT
EEDEGMEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGR
GSSAPSQ
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=135 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE
>gnl|bcl2dbpro|A0A2K6QIL2_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEDNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV
>gnl|bcl2dbpro|A0A2K6QK74_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Rhinopithecus roxellana GN=BIK (length=157 residues).
MSGVRPVSRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALRLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLTSFMDGFTTLKENIMRFWRSLNPGSQVSREQVLLALLLLLAALLSGGLHLLLK
>gnl|bcl2dbpro|A0A2K6QZT2_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6QZT2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6RAW1_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus roxellana GN=BMF (length=123 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYAPAEPKSRVVADPPLPAQPCFEWRRE
>gnl|bcl2dbpro|A0A2K6RAW1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinopithecus roxellana GN=BMF (length=184 residues).
MEPSRCVEELEDDVFQPEDGEPGAQPGSSLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLGPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVW
WQILLFLHNLALNGEENRNGAGPR
© 1998-2020Legal notice