Dataset for protein Puma of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        : *:.:: *.*. :* *  .:.*  *.  .          
---------------------------------------ikfGvgsarAcPcqvPrA--ssaTwvPcqic----------
mararqegsspepveglardgprpfplgrlvpsavscglcep laatp a all a ylcap ap avtaalggprwrhg
                                                                            epg 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------gpqpslslaeq------------------hlespvpsa---------------------------
prtrggqlprgrrpp-----------ppgalgsvlrplrarpgc---------rclplrphrptrrhrrpggpplawgsp
  sp     gap gd  rrpap par                   prc r a                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            * . 
-------pg-----alagg---aapgvrgeee----------------qwareigaqlrrmaddlnaqyerr-rqeEtrr
qpaprpt--rssal-----ptq----------pggpggrshpggpgsp------------------------v--- qqg
                           a aqr                rgggtv pgd gp aadggrpq a  aa    

       250       260       270       280       290       300        
....:....|....:....|....:....|....:....|....:....|....:....|....:...
  .:*  .* . : .    *   ..*:   *                                     
hrptPwrvLynpvqslyptPrltrgPqsprN-------------------------------------
aaas pla eglimghlgl aghqa emep gaqlgactrpvdvrdsggrplpppdtlasagdflctm
                                                                    
© 1998-2022Legal notice