Dataset for protein Puma of organism Rhinopithecus roxellana

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
ikfgvgsaracpcqvprassatwvpcqic---------------------------------------------------
-----------------------------mprerqgpstpgpvlplarrgpgprrpfplprrvpsavssvlrplrarpgc
                             ga a hegrs egqegg  d       a  galp g lgcg          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
hprlprtaarclplrphrptrrhrrpggppllwgsyqpaptptpgvtsalalaggaapgvggprwpggpggrsrprgpgs
e gcaap                   aa a apaaplc  rap arsa            a aqr        h g    

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    .   :       ... :     **  ** ..  *.            **           
------------------gprpslslaeqhlespvpsapg--ALagGPtqaapGvrg-eeeqwareiGAqlrrmaddlna
prgggtvgpgdrgparpdetqgqravrpletrgaaqtpyltp  t-  vssry t--l-------rn  ctgpv------
               aa  g  aa tpaaa     a h      eq  q phn apa tqgpqspql     actrpvdv

       250       260       270       280   
....:....|....:....|....:....|....:....|...
  .           ...      :                   
qyerrrqeeqqrhrpspwrvlynlimgl---------------
--svgdslprpltpadtldsagtm----lplprghrapemepn
rddg  pggp dpl  agaf cdflctm               
© 1998-2022Legal notice