Dataset for protein Puma of organism Rhinopithecus roxellana

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2K6QZT2_BBC3-03      ---------------------------------------IKFGVGSARAC
A0A2K6QZT2_BBC3-02      ---------------------------------------IKFGVGSARAC
A0A2K6QZT2_BBC3-04      ---------------------------------------IKFGVGSARAC
A0A2K6QZT2_BBC3-01      MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAA
                                                                : *:.:: *.

A0A2K6QZT2_BBC3-03      PCQVPRA--SSATWVPCQIC------------------------------
A0A2K6QZT2_BBC3-02      PCQVPRA--SSATWVPCQIC---GPRERHGPRTPGGQLPGARRGPGPRRP
A0A2K6QZT2_BBC3-04      PCQVPRA--SSATWVPCQIC-------------------------GPQPS
A0A2K6QZT2_BBC3-01      PALLPAAYLCAPTAPPAVTAALGGPRWPGGPRSR----PRGPRPDGPQPS
                        *. :* *  .:.*  *.  .                              

A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-02      APLPARPPGALGSVLRPLRARPGCHPRCPRPAARCLPLRPHRPTRRHRRP
A0A2K6QZT2_BBC3-04      LSLAEQ------------------HLESPVPSA-----------------
A0A2K6QZT2_BBC3-01      LSLAEQ------------------HLESPVPSA-----------------
                                                                          

A0A2K6QZT2_BBC3-03      --------------------------------------------------
A0A2K6QZT2_BBC3-02      GGPPLAWGSPQPAPRPTPGRSSALALAGG---AAPGVAGAQRPGGPGGRS
A0A2K6QZT2_BBC3-04      -----------------PG-----ALAGGPTQAAPGVRGEEE--------
A0A2K6QZT2_BBC3-01      -----------------PG-----ALAGGPTQAAPGVRGEEE--------
                                                                          

A0A2K6QZT2_BBC3-03      ------------------------------------ETRGAAATPPLALE
A0A2K6QZT2_BBC3-02      HPGGPGSPRGGGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATPPLALE
A0A2K6QZT2_BBC3-04      --------QWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWRVLY
A0A2K6QZT2_BBC3-01      --------QWAREIGAQLRRMADDLNAQYERR-RQEEQQRHRPSPWRVLY
                                                            * .   .:*  .* 

A0A2K6QZT2_BBC3-03      GPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDTLAS
A0A2K6QZT2_BBC3-02      GPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDSGGRPLPPPDTLAS
A0A2K6QZT2_BBC3-04      NLIMGLLPLPRGHRAPEMEPN-----------------------------
A0A2K6QZT2_BBC3-01      NLIMGLLPLPRGHRAPEMEPN-----------------------------
                        . : .    *   ..*:   *                             

A0A2K6QZT2_BBC3-03      AGDFLCTM
A0A2K6QZT2_BBC3-02      AGDFLCTM
A0A2K6QZT2_BBC3-04      --------
A0A2K6QZT2_BBC3-01      --------
                                

© 1998-2022Legal notice