Dataset for protein Puma of organism Rhinopithecus roxellana

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A2K6QZT2_BBC3-04 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BBC3 (length=131 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLR
RMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6QZT2_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLGRLVPSAVSCGLCEPGLAATPAAPALLPAAYLCAPTAPPAVTAALGGPRWPGG
PRSRPRGPRPDGPQPSLSLAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
>gnl|bcl2dbpro|A0A2K6QZT2_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BBC3 (length=261 residues).
IKFGVGSARACPCQVPRASSATWVPCQICGPRERHGPRTPGGQLPGARRGPGPRRPAPLPARPPGALGSVLRPLRARPGC
HPRCPRPAARCLPLRPHRPTRRHRRPGGPPLAWGSPQPAPRPTPGRSSALALAGGAAPGVAGAQRPGGPGGRSHPGGPGS
PRGGGTVGPGDRGPAAADGGRPQRAVRAAETRGAAATPPLALEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
>gnl|bcl2dbpro|A0A2K6QZT2_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Rhinopithecus roxellana GN=BBC3 (length=101 residues).
IKFGVGSARACPCQVPRASSATWVPCQICETRGAAATPPLALEGPVQSHYGTPALTQGPQSPRNGAQLGACTRPVDVRDS
GGRPLPPPDTLASAGDFLCTM
© 1998-2022Legal notice