Dataset for protein classical BH3-containing proteins of organism Rhinolophus ferrumequinum

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------kvpsdassec--dreggrlq------------------------------pgerppqlrpgaptsvq---ie
mfqmpyma-qsagearapvepcqvpqfpsgwvphqicgprerhgpstpggqlpgarrgsadgrlgtcgtslpradlfa--
   i eyer---m-ppqa  elpldv--                              -ewvdhaiqepq--gtapgvqs
      f qtgq-f--p    vldypss                              tvss  p--ac-hslspgcslr
        lseeed  m     g h                                 a rq   vl aralcll alcg
            c                                               p    sg  k g gg     
                                                                 p              
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                           .    
rqg-p-g-----p-----g----p-s-----------------------------------pa--scdkstqtpsPpcqa
---n-e-rgdrf-hgspq-pllp-a-pgpfatrsplfifvrrssllsrsssgyfsfdtdrs--pm-etqalellaassps
qldctqselqlcslthcccsgarrtrqssy                     ahrqqtsrgpllgwpasspapsev r---
pararlawptss cpggs lve  s h                         glhlhpg l  etlspphrkrtq artr
e  hqp qcper  haaa  p   h                                      a grkeemanag vqsg
         a                                                       ege    e e  pkd
                                                                 a           l  
                                                                             a  
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
fnhyl----------------------------------qp--lp---r-ei-iarelrrigdef-a-------------
ag---pcgvteepqrlfygnagyrlplpasfpsgmpsrr--qa--adl-p--w------------n-lyprrhqqnrnrv
q-vmtrgaapgiagaqrp cp g phprspgsaalalgersrerqwqhwaavrygqqvqcmatqlhrchmqqarevsysh
-ptea                           p ggthvg pvggpneqwgrqprikf aas rgsgstkplvlpkqvqt
lldl                                gaga gsa eeaan qec at    e k e afeg rglgpqgp
h aa                                f a   g   a    g           d d      pffeng a
                                          d                      a      f   la  
                                                                                
                                                                                

       250       260       270       280       290       300         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                     
-------l-nlwlrrdl-r-ga-----------------------------------------------
wwqplrl-q--------n-l--gtrtvdvrdlggrtlpppdalasagdifctmaqvaalaawllgrrnl
atviwlfthgpaspgaglqnwrcpsrmhpnrvtltrfraag  ptywpwl aa                
tpstrqvqywtrrnyseapglypspqfe l     fa                                
rhgmpiravtrnmitlvwls tmr e                                           
dgahgfnsslmligskrsar saq                                             
 e  aam rkkiafqipr     a                                             
      h ki g  l  f                                                   
      e e                                                            
© 1998-2021Legal notice