Dataset for protein classical BH3-containing proteins of organism Rhinolophus ferrumequinum

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------kvpsdassec--dreggrlqpgerppqlrpg-------appsvql--ierqgnpegegqrfph----gp---
mfqmpyma-qsagearapvepcqvpqfpsawvdlgicgpsrgrlgpsttgad-faqrqld-----ldlc--gspq--llp
   i eyer---m-ppqa  elpldv---edgrhptqet ae halrlsptaptgas---hgqsr----twtprarsgar
      f qtgq-f--p    vldypsstvss  a--ac    g aqsllsp ps--pppctlrwptstslshgclgvvl
        lseeed  m     g h   a rq   vg a       kh cl  glpvlkalqteqhpqsmqrrcd aqeg
            c                      s             ag  e lgeg g rapaaep  pg    c  
                                                     a c  a a d l   g  h        
                                                                a               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                    *                           
p-s-----------------------------------pa-m-cdkstqtpsPpcqafnhyl------------------
-a-pgpfatrsplfifvrrssllsrsssgyfsfdtdrs--p-se-qaresla sapsa----pcgvteepqrlfygnagy
rttrssy rcprrpcpaasclp rph pahrqqtsrgptvgwr-p--mtrev asl-qgvmwrgaapqvaglqrwllprr
asrqarp                      glhlhpg lllevpslgplrnaq r--r-ywptl tmagi aaaap cg g
 plh                                    dtggkehapl p grtptptlif                 
 c                                      a ede g ke e dpsgslge                   
                                           a  e  a        aad                   
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------qp--lp---r-ei-iarelrrigdef-a---------------------------------g--
rlplpasfpsgmpsrr--qa--adl-p--w------------n-lyprrhqqnrnrvwwqplrflhnlalrgdlnrn-ag
nphprspgsaalalgersrerqwqhwaavrygqqvqcmatqlhrchmqqarevsyshatviwlvaywtwsnyselqlwrp
         p ggthvg pvggpneqwgrqprikf aas rgsgstkplvlpkqvqttpstrqrtvlrrmptlvwpglym
             gaga gsa eeaan qec at    e k e afeg rglgpqgprhgmpinsskpniiskprls tc
             f a   g   a    g           d d      pffeng adgahgfmqqiklagrigfar sa
                   d                      a      f   la   e  aal kg i fqa a     
                                                               e e  g  l        

       250       260       270
....:....|....:....|....:....|
                              
------------------------------
prtvhvrrvtlttlrppdalasagdifctm
tsrmepndlggrffpaa             
spqfd l                       
r e                           
q                             
a                             
                              
© 1998-2020Legal notice