Dataset for protein classical BH3-containing proteins of organism Rhinolophus ferrumequinum

[Download (right click)] [Alignment] [Repertoires]

12 sequence(s)

>gnl|bcl2dbpro|A0A671DWL6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGDLGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQILLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A671DWL6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BMF (length=193 residues).
MPYYALTGEMEPPQCVEELEDDVFQPEDGDLGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQ
TLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQ
HQQNRNRVWWQILLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A671ELU4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BAD (length=163 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDQPPGPGKHLCTAPGLLGEAGHQQGQPASSSHHGGAGSVEPRSRHSSYPAGT
EEDEEMEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQNSSWTRIFQSLWRGGSA
SSQ
>gnl|bcl2dbpro|A0A671EYM5_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=PMAIP1 (length=119 residues).
VGSCFSPEPEVLGYPLSAVSSRLPSGPARPPGAQLASCRPQGATQGWGTEFPGGLQQTSRRLLAEMPGKKARKNAQPSPT
RAPAELEVECAIQFRRIGDKLSFRQKLLNLISKLFRSGT
>gnl|bcl2dbpro|A0A671EZ71_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A671F3X5_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BBC3 (length=259 residues).
RVSAGAARACPCQVPRLPSGWVPHQICGPRERHGPSTPGGQLPGARRGPGPRRPAPLPTQPPGALGCVLRPLRARPARCP
RRPCPAASCLPLRPHSPAHRHLHPGGPPLAWGSPQPAPRPAPRRSSALTLTRGAAPGIAGAQRPGCPGGRPHPRSPGSPG
GGGAVGPRDRGPAAANGGRPRRTVRAAETRGAAATPPLALEGPVQPDHGTAALTQGPWSPRDGAQLGACTRTVDVRDLGG
RTLPPPDALASAGDIFCTM
>gnl|bcl2dbpro|A0A671F3X5_BBC3-03 BCL2 binding component 3 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BBC3 (length=99 residues).
RVSAGAARACPCQVPRLPSGWVPHQICETRGAAATPPLALEGPVQPDHGTAALTQGPWSPRDGAQLGACTRTVDVRDLGG
RTLPPPDALASAGDIFCTM
>gnl|bcl2dbpro|A0A671F3X5_BBC3-02 BCL2 binding component 3 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BBC3 (length=129 residues).
RVSAGAARACPCQVPRLPSGWVPHQICGPQPSLSPAEQHLESPVPSAPGALAGGPTHAAPGVRGEEEQWAREIGAQLRRM
ADDLDALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A671FCV3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2L11 (length=196 residues).
MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSVQIERQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQPQALPADLRPEIWIAQELRRIGDEFNAC
YPRRVFLNNYRAAGAHPRMAVIRLLRYILRLLWRMQ
>gnl|bcl2dbpro|A0A671FCV3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2L11 (length=131 residues).
MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSVQIERQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLPE
>gnl|bcl2dbpro|A0A671FCV3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2L11 (length=156 residues).
MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSVQIERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQPQAL
PADLRPEIWIAQELRRIGDEFNACYPRRARFVLGSHTEVPGIEAEKKGARTAVLAGLYPRSRFHVLRVTLTFFRAA
>gnl|bcl2dbpro|A0A671FCV3_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Rhinolophus ferrumequinum GN=BCL2L11 (length=167 residues).
MAKQPSDASSECDREGGQLQPAERPPQLRPGAPTSVQIERQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASRRQPQALPADLRPEIWIAQELRRIGDEFNAC
YPRRFGQ
© 1998-2020Legal notice