Dataset for protein classical BH3-containing proteins of organism Rhinolophus ferrumequinum

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671EZ71_HRK-01       ----------------MC--PCPLHR------------------------
A0A671F3X5_BBC3-03      --------RVSAGAARAC--PCQVPRLP----------------------
A0A671F3X5_BBC3-01      --------RVSAGAARAC--PCQVPRLPSGWVPHQICGPRERHGPSTPGG
A0A671EYM5_PMAIP1-      ---------VGSCFSPEP--EVLGYPLS----------------------
A0A671DWL6_BMF-01       ------------MEPPQCVEELEDDVFQ----------------------
A0A671DWL6_BMF-02       ---MPYYALTGEMEPPQCVEELEDDVFQ----------------------
A0A671F3X5_BBC3-02      --------RVSAGAARAC--PCQVPRLP----------------------
A0A671ELU4_BAD-01       MFQIPEFEQSEQEDSSPA--DRGLGPSP----------------------
A0A671FCV3_BCL2L11      ------MAKQPSDASSEC--DREGGQLQ----------------------
A0A671FCV3_BCL2L11      ------MAKQPSDASSEC--DREGGQLQ----------------------
A0A671FCV3_BCL2L11      ------MAKQPSDASSEC--DREGGQLQ----------------------
A0A671FCV3_BCL2L11      ------MAKQPSDASSEC--DREGGQLQ----------------------
                                                                          

A0A671EZ71_HRK-01       ---------GRGPPAVCACSAGRLG-------------------------
A0A671F3X5_BBC3-03      --------SGWVPHQICET---RGA-------------------------
A0A671F3X5_BBC3-01      QLPGARRGPGPRRPAPLPTQPPGALGCVLRPLRARPARCPRRPCPAASCL
A0A671EYM5_PMAIP1-      --------AVSSRLPSGPARPPGAQLASCRPQGATQGWGTEFP-------
A0A671DWL6_BMF-01       --------PEDGDLGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGP
A0A671DWL6_BMF-02       --------PEDGDLGTQPGSLPSADLFAQSQLDCPLSRLQLFPLTHCCGP
A0A671F3X5_BBC3-02      --------SGWVPHQICGPQPSLSP-------------------------
A0A671ELU4_BAD-01       --------TGDQPPG--PGKHLCTAPGLLGEAGHQQGQPASSSHHGGAGS
A0A671FCV3_BCL2L11      --------PAERPPQLRPGAPTSVQ---IERQ------------------
A0A671FCV3_BCL2L11      --------PAERPPQLRPGAPTSVQ---IERQGNPEGEGDRCPHGSPQGP
A0A671FCV3_BCL2L11      --------PAERPPQLRPGAPTSVQ---IERQGNPEGEGDRCPHGSPQGP
A0A671FCV3_BCL2L11      --------PAERPPQLRPGAPTSVQ---IERQGNPEGEGDRCPHGSPQGP
                                                                          

A0A671EZ71_HRK-01       ---------------------------------------------LRSSA
A0A671F3X5_BBC3-03      ---------------------------------------------AATPP
A0A671F3X5_BBC3-01      PLRPHSP------------------------AHRHLHPGGPPLAWGSPQP
A0A671EYM5_PMAIP1-      -------------------------------GGLQQTSRRLLAEMPGKKA
A0A671DWL6_BMF-01       GLRPTSQ---------------------------------------EDKA
A0A671DWL6_BMF-02       GLRPTSQ---------------------------------------EDKA
A0A671F3X5_BBC3-02      ----------------------------------------------AEQH
A0A671ELU4_BAD-01       VEPRSRHSSY-------------------------------PAGTEEDEE
A0A671FCV3_BCL2L11      --------------------------------------DRSPAPMSCDKS
A0A671FCV3_BCL2L11      LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKS
A0A671FCV3_BCL2L11      LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKS
A0A671FCV3_BCL2L11      LAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKS
                                                                          

A0A671EZ71_HRK-01       AQLTAARLKALGDEL-----------------------------------
A0A671F3X5_BBC3-03      LALEGPVQPDHGTAA-----------------------------------
A0A671F3X5_BBC3-01      APRPAPRRSSALTLTRGAAPGIAGAQRPGCPGGRPHPRSPGSPGGGGAVG
A0A671EYM5_PMAIP1-      RKNAQPSPTRAPAEL-----------------------------------
A0A671DWL6_BMF-01       TQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQ
A0A671DWL6_BMF-02       TQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQ
A0A671F3X5_BBC3-02      LESPVPSAPGA---L---------------------------AGGPTHAA
A0A671ELU4_BAD-01       MEEEEPS--------------------------------------PFRGR
A0A671FCV3_BCL2L11      TQTPSPPCQAFNHYL---------------------------SAMASRRQ
A0A671FCV3_BCL2L11      TQTPSPPCQAFNHYL---------------------------SAMASRRQ
A0A671FCV3_BCL2L11      TQTPSPPCQAFNHYL---------------------------SAM-----
A0A671FCV3_BCL2L11      TQTPSPPCQAFNHYL---------------------------SAMASRRQ
                             .                                            

A0A671EZ71_HRK-01       ----------------------------------------------HQRT
A0A671F3X5_BBC3-03      ----------------------------------------------LTQG
A0A671F3X5_BBC3-01      PRDRGPAAANGGRPRRTVRAAETRGAAATPPLALEGPVQPDHGTAALTQG
A0A671EYM5_PMAIP1-      ----------EVECAIQFRRIGDKLS-------------------FRQKL
A0A671DWL6_BMF-01       PPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRVWWQILLFLHN
A0A671DWL6_BMF-02       PPEGQWQHRAEIQIARKLQCIADQFHRLHMQQHQQNRNRVWWQILLFLHN
A0A671F3X5_BBC3-02      PGVRGEEEQWAREIGAQLRRMADDLDALYERRRQEEQQRHRPSPWRVLYN
A0A671ELU4_BAD-01       SRSAPPNLWAAQRYGRELRRMSDEFEGSFKGLPRPKSAGTATQMRQNSSW
A0A671FCV3_BCL2L11      PQALPADLRPEIWIAQELRRIGDEFNACYPRRARFVLGSHTEVPGIEAEK
A0A671FCV3_BCL2L11      PQALPADLRPEIWIAQELRRIGDEFNACYPRRVFLNNYRAAGAHPRMAVI
A0A671FCV3_BCL2L11      --GLPE--------------------------------------------
A0A671FCV3_BCL2L11      PQALPADLRPEIWIAQELRRIGDEFNACYPRRFGQ---------------
                                                                          

A0A671EZ71_HRK-01       MWRRRARS----------------RRAPAPGALPTYWPWLCAAAQVAALA
A0A671F3X5_BBC3-03      PWSPRDGAQLGACTRTVDVRDLGGRTLPPPDALASAGDIFCTM-------
A0A671F3X5_BBC3-01      PWSPRDGAQLGACTRTVDVRDLGGRTLPPPDALASAGDIFCTM-------
A0A671EYM5_PMAIP1-      LNLISKLFRSGT--------------------------------------
A0A671DWL6_BMF-01       LALNGDENRNGAGPR-----------------------------------
A0A671DWL6_BMF-02       LALNGDENRNGAGPR-----------------------------------
A0A671F3X5_BBC3-02      LIMGLLPLPRGRGAPEMEPN------------------------------
A0A671ELU4_BAD-01       TRIFQSLWRGGSASSQ----------------------------------
A0A671FCV3_BCL2L11      KGARTAVLAGLYPRSRFHVLRVTLTFFRAA--------------------
A0A671FCV3_BCL2L11      RLLRYILRLLWRMQ------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      --------------------------------------------------
                                                                          

A0A671EZ71_HRK-01       AWLLGRRNL
A0A671F3X5_BBC3-03      ---------
A0A671F3X5_BBC3-01      ---------
A0A671EYM5_PMAIP1-      ---------
A0A671DWL6_BMF-01       ---------
A0A671DWL6_BMF-02       ---------
A0A671F3X5_BBC3-02      ---------
A0A671ELU4_BAD-01       ---------
A0A671FCV3_BCL2L11      ---------
A0A671FCV3_BCL2L11      ---------
A0A671FCV3_BCL2L11      ---------
A0A671FCV3_BCL2L11      ---------
                                 

© 1998-2021Legal notice