Dataset for protein classical BH3-containing proteins of organism Rhinolophus ferrumequinum

[Download (right click)] [Edit] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A671F3X5_BBC3-01      --------RVSAGAARAC--PCQVPRLPSGWVPHQICGP-RERHGPSTPG
A0A671EZ71_HRK-01       ----------------MC--PCPLHR---GRGPPAVCACSAGRLGLRSSA
A0A671F3X5_BBC3-03      --------RVSAGAARAC--PCQVPRLPSGWVPHQICET---RGAAATPP
A0A671EYM5_PMAIP1-      ---------VGSCFSPEP--EVLGYPLSAVSSRLPSGPA-------RPPG
A0A671DWL6_BMF-01       ------------MEPPQCVEELEDDVFQPEDGDLGTQPG-------SLPS
A0A671DWL6_BMF-02       ---MPYYALTGEMEPPQCVEELEDDVFQPEDGDLGTQPG-------SLPS
A0A671F3X5_BBC3-02      --------RVSAGAARAC--PCQVPRLPSGWVPHQICGP-------QPSL
A0A671ELU4_BAD-01       MFQIPEFEQSEQEDSSPA--DRGLGPSPTGDQPPG--PG-------KHLC
A0A671FCV3_BCL2L11      ------MAKQPSDASSEC--DREGGQLQPAERPPQLRPG-------APTS
A0A671FCV3_BCL2L11      ------MAKQPSDASSEC--DREGGQLQPAERPPQLRPG-------APTS
A0A671FCV3_BCL2L11      ------MAKQPSDASSEC--DREGGQLQPAERPPQLRPG-------APTS
A0A671FCV3_BCL2L11      ------MAKQPSDASSEC--DREGGQLQPAERPPQLRPG-------APTS
                                                                          

A0A671F3X5_BBC3-01      GQLPGARRGPGPRRPAPLPTQPPGALGCVLRPLRARPARCPRRPCPAASC
A0A671EZ71_HRK-01       AQLTAARLKALGDELHQRTMWRRRARS-----------------------
A0A671F3X5_BBC3-03      LALEGPVQPDHGTAALTQGPWSPRDGAQLGACTR----------------
A0A671EYM5_PMAIP1-      AQLASCRPQGATQGWGTEFP------------------------------
A0A671DWL6_BMF-01       ADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQ----------------
A0A671DWL6_BMF-02       ADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQ----------------
A0A671F3X5_BBC3-02      SP------------------------------------------------
A0A671ELU4_BAD-01       TAPGLLGEAGHQQGQPASSSHHGGAGSVEPRSRHSSY-------------
A0A671FCV3_BCL2L11      VQ---IERQ-----------------------------------------
A0A671FCV3_BCL2L11      VQ---IERQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS
A0A671FCV3_BCL2L11      VQ---IERQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS
A0A671FCV3_BCL2L11      VQ---IERQGNPEGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRS
                                                                          

A0A671F3X5_BBC3-01      LPLRPHSPAHRHLHPGGPPLAWGSPQPAPRPAPRRSSALTLTRGAAPGIA
A0A671EZ71_HRK-01       ---------------------------RRAPAPGALPTYWPWLCAAAQVA
A0A671F3X5_BBC3-03      ------------------TVDVRDLGGRTLPPPDALASAGDIFCTM----
A0A671EYM5_PMAIP1-      --------GGLQQTSRRLLAEMPGKKARKNAQPSPTRAPAEL--------
A0A671DWL6_BMF-01       -----------------------EDKATQTLSPASPSQGVMLPCGVTEEP
A0A671DWL6_BMF-02       -----------------------EDKATQTLSPASPSQGVMLPCGVTEEP
A0A671F3X5_BBC3-02      -----------------------AEQHLESPVPSAPGA---L--------
A0A671ELU4_BAD-01       ------------------PAGTEEDEEMEEEEPS----------------
A0A671FCV3_BCL2L11      ---------------DRSPAPMSCDKSTQTPSPPCQAFNHYL--------
A0A671FCV3_BCL2L11      SLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL--------
A0A671FCV3_BCL2L11      SLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL--------
A0A671FCV3_BCL2L11      SLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYL--------
                                                        *                 

A0A671F3X5_BBC3-01      GAQRPGCPGGRPHPRSPGSPGGGGAVGPRDRGPAAANGGRPRRTVRAAET
A0A671EZ71_HRK-01       ALAAWLLGRRNL--------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A671EYM5_PMAIP1-      -------------------------------------EVECAIQFRRIGD
A0A671DWL6_BMF-01       QRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIAD
A0A671DWL6_BMF-02       QRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIAD
A0A671F3X5_BBC3-02      -------------------AGGPTHAAPGVRGEEEQWAREIGAQLRRMAD
A0A671ELU4_BAD-01       ----------------------PFRGRSRSAPPNLWAAQRYGRELRRMSD
A0A671FCV3_BCL2L11      -------------------SAMASRRQPQALPADLRPEIWIAQELRRIGD
A0A671FCV3_BCL2L11      -------------------SAMASRRQPQALPADLRPEIWIAQELRRIGD
A0A671FCV3_BCL2L11      -------------------SAM-------GLPE-----------------
A0A671FCV3_BCL2L11      -------------------SAMASRRQPQALPADLRPEIWIAQELRRIGD
                                                                          

A0A671F3X5_BBC3-01      RGAAATPPLALEGPVQPDHGTAALTQGPWSPRDGAQLGACTRTVDVRDLG
A0A671EZ71_HRK-01       --------------------------------------------------
A0A671F3X5_BBC3-03      --------------------------------------------------
A0A671EYM5_PMAIP1-      KLS-------------------FRQKLLNLISKLFRSGT-----------
A0A671DWL6_BMF-01       QFHRLHMQQHQQNRNRVWWQILLFLHNLALNGDENRNGAGPR--------
A0A671DWL6_BMF-02       QFHRLHMQQHQQNRNRVWWQILLFLHNLALNGDENRNGAGPR--------
A0A671F3X5_BBC3-02      DLDALYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN---
A0A671ELU4_BAD-01       EFEGSFKGLPRPKSAGTATQMRQNSSWTRIFQSLWRGGSASSQ-------
A0A671FCV3_BCL2L11      EFNACYPRRARFVLGSHTEVPGIEAEKKGARTAVLAGLYPRSRFHVLRVT
A0A671FCV3_BCL2L11      EFNACYPRRVFLNNYRAAGAHPRMAVIRLLRYILRLLWRMQ---------
A0A671FCV3_BCL2L11      --------------------------------------------------
A0A671FCV3_BCL2L11      EFNACYPRRFGQ--------------------------------------
                                                                          

A0A671F3X5_BBC3-01      GRTLPPPDALASAGDIFCTM
A0A671EZ71_HRK-01       --------------------
A0A671F3X5_BBC3-03      --------------------
A0A671EYM5_PMAIP1-      --------------------
A0A671DWL6_BMF-01       --------------------
A0A671DWL6_BMF-02       --------------------
A0A671F3X5_BBC3-02      --------------------
A0A671ELU4_BAD-01       --------------------
A0A671FCV3_BCL2L11      LTFFRAA-------------
A0A671FCV3_BCL2L11      --------------------
A0A671FCV3_BCL2L11      --------------------
A0A671FCV3_BCL2L11      --------------------
                                            

© 1998-2020Legal notice