Dataset for protein classical BH3-containing proteins of organism Rhinolophus ferrumequinum

[Download (right click)] [Sequences] [Repertoires]

12 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


A0A671F3X5_BBC3-01         ------------RVSAGAARACPCQVPRLPSGWVPHQICGPRERHGPSTP
A0A671F3X5_BBC3-02         ------------RVSAGAARACPC-------------------------Q
A0A671FCV3_BCL2L11-02      --M--------AKQPSDASSECDR-------------------------E
A0A671FCV3_BCL2L11-01      --M--------AKQPSDASSECDR-------------------------E
A0A671FCV3_BCL2L11-03      --M--------AKQPSDASSECDR-------------------------E
A0A671EYM5_PMAIP1-01       VGS--------CFSP-----EPEV-------------------------L
A0A671EZ71_HRK-01          --M--------CPCP-----LHRG-------------------------R
A0A671DWL6_BMF-02          --MPYYALTGEMEPPQ-CVEE--L-------------------------E
A0A671ELU4_BAD-01          --M--------FQIPE--FEQ--S-------------------------E
A0A671DWL6_BMF-01          -----------MEPPQ-CVEE--L-------------------------E
A0A671F3X5_BBC3-03         ------------RVSAGAARACPCQVPRLPSGWVPHQIC-----------
A0A671FCV3_BCL2L11-04      --M--------AKQPSDASSECDR-------------------------E
                                         .                                   

A0A671F3X5_BBC3-01         GGQLPGAR-RGPGPRR-PAPLPT---QPP-GALGCVLRPLRARPARCPRR
A0A671F3X5_BBC3-02         VPRLPSGW-VPHQICG-PQPSLS---PAEQH-------------------
A0A671FCV3_BCL2L11-02      GGQLQPAE-RPPQLRP-GAPTSV---QIERQGNP------EGEGDRCP--
A0A671FCV3_BCL2L11-01      GGQLQPAE-RPPQLRP-GAPTSV---QIERQGNP------EGEGDRCP--
A0A671FCV3_BCL2L11-03      GGQLQPAE-RPPQLRP-GAPTSV---QIERQ-------------------
A0A671EYM5_PMAIP1-01       GYPLSAVSSRLP-SGP-ARPPGAQLASCRPQGAT------QGWGTEFP--
A0A671EZ71_HRK-01          GPPAVCACSAGR-LG--LRSSAAQLTAARLKALG----------DEL---
A0A671DWL6_BMF-02          DDVFQPED-GDLGTQP-GSLPSA---DLFAQSQL------D-----CP--
A0A671ELU4_BAD-01          QEDSSPAD-RGLGPSPTGDQPPG---------------------------
A0A671DWL6_BMF-01          DDVFQPED-GDLGTQP-GSLPSA---DLFAQSQL------D-----CP--
A0A671F3X5_BBC3-03         --------------------------------------------------
A0A671FCV3_BCL2L11-04      GGQLQPAE-RPPQLRP-GAPTSV---QIERQGNP------EGEGDRCP--
                                                                             

A0A671F3X5_BBC3-01         PCPAASCLPLRPHSPAHRHLHPG-GPPLAW-GSPQPAPRPAP-----RRS
A0A671F3X5_BBC3-02         --------------------------------------------------
A0A671FCV3_BCL2L11-02      ------------------HGSPQ-GPLAPP-ASPGPFATRSPLFIFVRRS
A0A671FCV3_BCL2L11-01      ------------------HGSPQ-GPLAPP-ASPGPFATRSPLFIFVRRS
A0A671FCV3_BCL2L11-03      --------------------------------------------------
A0A671EYM5_PMAIP1-01       ------------------GGLQQ-TSR-----------------------
A0A671EZ71_HRK-01          ---------------------H----------------------------
A0A671DWL6_BMF-02          ------------------LSRLQLFPLTHC-CGPGLRPTS----------
A0A671ELU4_BAD-01          -------------------------PGKHLCTAPGLLGEA----------
A0A671DWL6_BMF-01          ------------------LSRLQLFPLTHC-CGPGLRPTS----------
A0A671F3X5_BBC3-03         --------------------------------------------------
A0A671FCV3_BCL2L11-04      ------------------HGSPQ-GPLAPP-ASPGPFATRSPLFIFVRRS
                                                                             

A0A671F3X5_BBC3-01         SALTLTRGAAPGIAGAQRPGCPGGRPHPRSPGSPGGGGAVGPRDRGPAAA
A0A671F3X5_BBC3-02         -------------------------------------------LESPVPS
A0A671FCV3_BCL2L11-02      SLLSRSSS----------------------------GYFSFDTDRSPAPM
A0A671FCV3_BCL2L11-01      SLLSRSSS----------------------------GYFSFDTDRSPAPM
A0A671FCV3_BCL2L11-03      -------------------------------------------DRSPAPM
A0A671EYM5_PMAIP1-01       --------------------------------------------RLLAEM
A0A671EZ71_HRK-01          ----------------------------------------------QRTM
A0A671DWL6_BMF-02          --------------------------------------------------
A0A671ELU4_BAD-01          --------------------------------------------------
A0A671DWL6_BMF-01          --------------------------------------------------
A0A671F3X5_BBC3-03         --------------------------------------------------
A0A671FCV3_BCL2L11-04      SLLSRSSS----------------------------GYFSFDTDRSPAPM
                                                                             

A0A671F3X5_BBC3-01         NGGRPRRTVRA-------AETRGAA------------AT--P--PLALEG
A0A671F3X5_BBC3-02         APGALAGGP---------------T------------HA--A--PGVRGE
A0A671FCV3_BCL2L11-02      SCDKSTQTPSPPCQAFNHYLSAMGL-------------------------
A0A671FCV3_BCL2L11-01      SCDKSTQTPSPPCQAFNHYLSAMAS------------RR--Q--PQALPA
A0A671FCV3_BCL2L11-03      SCDKSTQTPSPPCQAFNHYLSAMAS------------RR--Q--PQALPA
A0A671EYM5_PMAIP1-01       PGKKARKNAQP------------------------------S--PTRAPA
A0A671EZ71_HRK-01          WRRRARSRRAP------------------------------A--PGALPT
A0A671DWL6_BMF-02          QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL--PASFPA
A0A671ELU4_BAD-01          ----GHQQGQPASSSH----------------HGGAGSVEPRSRHSSYPA
A0A671DWL6_BMF-01          QEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPL--PASFPA
A0A671F3X5_BBC3-03         -------------------ETRGAA------------AT--P--PLALEG
A0A671FCV3_BCL2L11-04      SCDKSTQTPSPPCQAFNHYLSAMAS------------RR--Q--PQALPA
                                                                             

A0A671F3X5_BBC3-01         PVQPDHGTAALTQ---------------GPW----SPRDGA-QLGACTRT
A0A671F3X5_BBC3-02         EE-------------------------------QWAREIGA-QLRRMADD
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A671FCV3_BCL2L11-01      DL-------------------------------RPEIWIAQ-ELRRIGDE
A0A671FCV3_BCL2L11-03      DL-------------------------------RPEIWIAQ-ELRRIGDE
A0A671EYM5_PMAIP1-01       EL---------------------------------EVECAI-QFRRIGDK
A0A671EZ71_HRK-01          YW---------------------------------PWLCAAAQVAALAAW
A0A671DWL6_BMF-02          GL--PLGE-QPPE---------------GQWQHRAEIQIAR-KLQCIADQ
A0A671ELU4_BAD-01          GT--EEDE-EMEEEEPSPFRGRSRSAPPNLW---AAQRYGR-ELRRMSDE
A0A671DWL6_BMF-01          GL--PLGE-QPPE---------------GQWQHRAEIQIAR-KLQCIADQ
A0A671F3X5_BBC3-03         PVQPDHGTAALTQ---------------GPW----SPRDGA-QLGACTRT
A0A671FCV3_BCL2L11-04      DL-------------------------------RPEIWIAQ-ELRRIGDE
                                                                             

A0A671F3X5_BBC3-01         VDVRDLGGRTL---------------------P------------PPDAL
A0A671F3X5_BBC3-02         ---LDALYERRRQEEQQRHRPSP-------------------WRV---LY
A0A671FCV3_BCL2L11-02      --------------------------------------------------
A0A671FCV3_BCL2L11-01      ---FNACYPRRVFL------------------NNYRAAGAHPRMAVIRLL
A0A671FCV3_BCL2L11-03      ---FNACYPRRARFVLGSHTEVPGIEAEKKGARTAVLAGLYPRS-RFHVL
A0A671EYM5_PMAIP1-01       ---LSF---------------------------------------RQKLL
A0A671EZ71_HRK-01          ---LL---------------------------------------------
A0A671DWL6_BMF-02          ---FHRLH------------------------------MQQHQQNRNRVW
A0A671ELU4_BAD-01          ---FEGSFKGL---------------------PRPKSAGTATQMRQNSSW
A0A671DWL6_BMF-01          ---FHRLH------------------------------MQQHQQNRNRVW
A0A671F3X5_BBC3-03         VDVRDLGGRTL---------------------P------------PPDAL
A0A671FCV3_BCL2L11-04      ---FNACYPRRF--------------------------------------
                                                                             

A0A671F3X5_BBC3-01         ASAGD-I--------------FCTM
A0A671F3X5_BBC3-02         NLIMGLL---PLPRGRGAP-EMEPN
A0A671FCV3_BCL2L11-02      -----------------------PE
A0A671FCV3_BCL2L11-01      RYILRLL--------------WRMQ
A0A671FCV3_BCL2L11-03      RVTLT-F--------------FRAA
A0A671EYM5_PMAIP1-01       NLISKLF--------------RSGT
A0A671EZ71_HRK-01          ------G--------------RRNL
A0A671DWL6_BMF-02          WQILLFLHNLALNGDENRN-GAGPR
A0A671ELU4_BAD-01          TRIFQSLW---------RGGSASSQ
A0A671DWL6_BMF-01          WQILLFLHNLALNGDENRN-GAGPR
A0A671F3X5_BBC3-03         ASAGD-I--------------FCTM
A0A671FCV3_BCL2L11-04      -----------------------GQ
                                                    

© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice