Dataset for protein classical BH3-containing proteins of organism Pseudonaja textilis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------l-------hld--dsd--g-----------------------
makqssdlnsecereggqlqpaerpaqphhlrpgppvy-rtryqss---sr---vv-spqgplvsqsspspfrgiftqsk
                                mda ts qreiggnq ggltdssph ddce app  kma        a
                                    le eddf  d   ee   ef                        

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              . . . ..          
--------------------------------------------------------------gyrwrsrpip--------
tyspllmrvrrspltsrsssgyrhskqqdrstqtmncssstqtpsppcqvtnhpqrlyysnrasklqvqtagftlnphlq
srnc fgffqlf  lhccgp s fafdi kapapl adkas diml  gaiee    flgam g ehq s a        
                                                             a f a              

       170       180       190       200       210       220       230         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
                . :*. :.*:::                                                   
-------stlwtevwiareLrrigDefn------r-----hldr---n----lrqwllylvsliwrvs-----------
eepqeslqimrpsqrygqq qcms qwhgsyrpr-lgtcs----qqv-wqqvwwsrwhnshrklmnpqtnsqsvpstln
       peeqcaiq  lk    a k  alpc ksg    lmqyppqsrnitilrli fignfalcmgrfrpragqr  
       ed ea  m                    a        hgp hkdi   i    f d falea          
© 1998-2020Legal notice