Dataset for protein classical BH3-containing proteins of organism Pseudonaja textilis

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A670XMZ5_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Pseudonaja textilis GN=BMF (length=193 residues).
MDPPVYLEDDFSHLDGLDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGPGSRHAKQQDKATQT
LNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQPIGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQILLFLHNLALNVEANRQRVGQR
>gnl|bcl2dbpro|A0A670Y3D3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pseudonaja textilis GN=BCL2L11 (length=197 residues).
MAKQSSDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGERDSSSPGSPQGPLAPPSSPSPFATRSPLFM
FVRRSPLLSRSSSGYFSFDIDRSPAPMNCDKATQTPSPPCQAINHYLSAMASRWQSRPIPEDMQPEIWIAQELRRIGDEF
NASYCPRRGLLDYQGVNHQIIILRLLHYIVRFIWRMQ
>gnl|bcl2dbpro|A0A670YRG7_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Pseudonaja textilis GN=BAD (length=103 residues).
LELRRRIGSDQLDSETSDEVGAFRARSRSAPPILWAAQRYGRELRRMSDEFHGLPRPKSAGTCSHMDRPPPSWKDTLRSW
WLYSGSDIMALSRFSPSAPSTLN
>gnl|bcl2dbpro|A0A670ZS96_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Pseudonaja textilis GN=PMAIP1 (length=49 residues).
RGGKERQRTAASTEECSVMIALQLRRIGDKWNLRQRILNLFSKLFCPGT
© 1998-2020Legal notice