Dataset for protein classical BH3-containing proteins of organism Pseudonaja textilis

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670ZS96_PMAIP1-      --------------------------------------------------
A0A670YRG7_BAD-01       ------------------------------------LELRRRIGSDQLDS
A0A670XMZ5_BMF-01       --------------------------------MDPPVYLEDDF--SHLDG
A0A670Y3D3_BCL2L11      MAKQSSDLNSECEREGGQLQPAERPAQPHHLRPGAPTSLQTEYQGNHLGE
                                                                          

A0A670ZS96_PMAIP1-      --------------------------------------------------
A0A670YRG7_BAD-01       ETSDEVG-------------------------------------------
A0A670XMZ5_BMF-01       LDDDVFHSDDCELVSQSSKMAFRGIFTQSKSYNCLLGRFQLFPLTHCCGP
A0A670Y3D3_BCL2L11      RDSSSPGSPQGPLAPPSSPSPF-------ATRSPLFMFVRRSPLLSRSSS
                                                                          

A0A670ZS96_PMAIP1-      -----------------------------------------RGGKERQRT
A0A670YRG7_BAD-01       ------------------------------------------AFRARSRS
A0A670XMZ5_BMF-01       GSRHAKQQDKATQTLNASSSSQDIMLPCGVTEEPQRLFYGNAGYRLHVQP
A0A670Y3D3_BCL2L11      GY-FSFDIDRSPAPMNCDKATQTPSPPCQAINH----YLSAMASRWQSRP
                                                                  . . . ..

A0A670ZS96_PMAIP1-      AA---------------STEECSVMIALQLRRIGDKWN------------
A0A670YRG7_BAD-01       AP---------------PILWAAQRYGRELRRMSDEFHGLPRPKSAGTCS
A0A670XMZ5_BMF-01       IGFTLNPHLQEEPQESLQELRTEVQIARKLQCIADQFH------RL----
A0A670Y3D3_BCL2L11      IP---------------EDMQPEIWIAQELRRIGDEFNASYCPRRG----
                                                  . :*. :.*:::            

A0A670ZS96_PMAIP1-      ------------LRQRILNLFSKLFCPGT----------
A0A670YRG7_BAD-01       HMDRPPPSWKDTLRSWWLYSGSDIMALSRFSPSAPSTLN
A0A670XMZ5_BMF-01       HLQRHQQNRNQVWWQILLFLHNLALNVEANRQRVGQR--
A0A670Y3D3_BCL2L11      LLDYQGVNHQIIILRLLHYIVRFIWRMQ-----------
                                                               

© 1998-2020Legal notice