Dataset for protein Bim of organism Pongo abelii

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mfpaaaagaarargaacgalgcpaerggglagrrglraalgtlspspglcllrcfrgdgqgvpgrrsaragrrgarsrar
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
              *****************************************                         
--------------MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ-------------------------
tlrsegkaqtkkdq                                         gnpegnhggegdscphgspqgplap
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                   ******************************    :         :
-----------------------------------DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMasmrqaepadmrpei
paspgpfatrsplfifmrrssllsrsssgyfsfdt                              ----edigs---isl
                                                                 vvild a dsl  a 
                                                                                
                                                                                

       250       260       270       280       290    
....:....|....:....|....:....|....:....|....:....|....
   :   *   .                                          
w--iaqeLrrigdefnayyarrvfl-----------------------------
hrfvqws ewyakss---------knnyqaaedhprmvilrllryivrlvwrmh
fge ftp dll hhhsqdteqlns-pps                          
                      mh dfd                          
                      le                              
© 1998-2023Legal notice