Dataset for protein Bim of organism Pongo abelii

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A2J8SGU7_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=172 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRMSLPPD
>gnl|bcl2dbpro|A0A2J8SGU7_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=138 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPA
DMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2J8SGU7_BCL2L11-05 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=97 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDAGSSLRI
ALHREVQWPLEWLAKSS
>gnl|bcl2dbpro|A0A2J8SGU7_BCL2L11-06 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=111 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD
ISLFGFIFTSLDLYGHHHSQDTEQLNHKDFS
>gnl|bcl2dbpro|A0A2J8SGU7_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=292 residues).
MFPAAAAGAARARGAACGALGCPAERGGGLAGRRGLRAALGTLSPSPGLCLLRCFRGDGQGVPGRRSARAGRRGARSRAR
TLRSEGKAQTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAP
PASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEI
WIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
>gnl|bcl2dbpro|A0A2J8SGU7_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Pongo abelii GN=BCL2L11 (length=169 residues).
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLF
IFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFN
AYYARRLEK
© 1998-2023Legal notice