Dataset for protein Bim of organism Pongo abelii

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2J8SGU7_BCL2L11      --------------------------------------------------
A0A2J8SGU7_BCL2L11      --------------------------------------------------
A0A2J8SGU7_BCL2L11      MFPAAAAGAARARGAACGALGCPAERGGGLAGRRGLRAALGTLSPSPGLC
A0A2J8SGU7_BCL2L11      --------------------------------------------------
A0A2J8SGU7_BCL2L11      --------------------------------------------------
A0A2J8SGU7_BCL2L11      --------------------------------------------------
                                                                          

A0A2J8SGU7_BCL2L11      --------------------------------------------MAKQPS
A0A2J8SGU7_BCL2L11      --------------------------------------------MAKQPS
A0A2J8SGU7_BCL2L11      LLRCFRGDGQGVPGRRSARAGRRGARSRARTLRSEGKAQTKKDQMAKQPS
A0A2J8SGU7_BCL2L11      --------------------------------------------MAKQPS
A0A2J8SGU7_BCL2L11      --------------------------------------------MAKQPS
A0A2J8SGU7_BCL2L11      --------------------------------------------MAKQPS
                                                                    ******

A0A2J8SGU7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2J8SGU7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2J8SGU7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2J8SGU7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQ---------------
A0A2J8SGU7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
A0A2J8SGU7_BCL2L11      DVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCP
                        ***********************************               

A0A2J8SGU7_BCL2L11      ---------------------------------------------DRSPA
A0A2J8SGU7_BCL2L11      ---------------------------------------------DRSPA
A0A2J8SGU7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2J8SGU7_BCL2L11      ---------------------------------------------DRSPA
A0A2J8SGU7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
A0A2J8SGU7_BCL2L11      HGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPA
                                                                     *****

A0A2J8SGU7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAM----DDAGSSLRIALHREVQWPLEW
A0A2J8SGU7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGD---ISLFGFIFTSLDL
A0A2J8SGU7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIW--IAQELRR
A0A2J8SGU7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIW--IAQELRR
A0A2J8SGU7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIW--IAQELRR
A0A2J8SGU7_BCL2L11      PMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIW--IAQELRR
                        *************************    :         :   :   *  

A0A2J8SGU7_BCL2L11      LAKSS---------------------------------------
A0A2J8SGU7_BCL2L11      YGHHHSQDTEQLNHKDFS--------------------------
A0A2J8SGU7_BCL2L11      IGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2J8SGU7_BCL2L11      IGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
A0A2J8SGU7_BCL2L11      IGDEFNAYYARRMSLPPD--------------------------
A0A2J8SGU7_BCL2L11      IGDEFNAYYARRLEK-----------------------------
                         .                                          

© 1998-2023Legal notice