Dataset for protein classical BH3-containing proteins of organism Podarcis muralis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------mdspdyleedfsnldgleddvfhsedcglasqpnemtfpgiftqsksyncllgrfql
makmnsyievtltsvgmdlfpge---------------------------------------------------------
   qs dltsecgre gq q a rpaqhlrpgapts     qt yqgnhs erdtsspsspq plapps pspfat sp 
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                .       .                                     . 
fplthccgpgtrhak-----qqdkatqtlnpssssqdvmlpcgvteepqrlfygnagfrlhvnpigfslsphlreepres
---------------gyfsf----------mpnqrltwtpap-------------------------------swtsdsi
 ifvrrsplls sss     dt rspapmsfnkitkeps  latf          qa shylsamay       trn  e
                             ecd a   lq    pa                             aq   a
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     .    . :*. :.*:::                                                          
pqelrtevqiarkLqciaDqfhrlhlqr-----l--p---------------------------------l-p-------
-----avrwygle rrmg ewn------icmkd-hf-llsvkikvrfpprilstcsavgkkkgmvrfera-q-qrnqvyt
 piiwpaqrc  q    s k  lsysplrllskyqrvntqitatrmrrylvwlivlqswwrrnspgngprhdqn egtw 
 ed    ie             arqki ngiq  pc ksagi lqllhtigrke                sy        
                            gefl  fa eh                                p        

       250       260       270       280       290    
....:....|....:....|....:....|....:....|....:....|....
                                                      
------------w---l------------r--agr-------------------
qlypttgsegtl-rls-flhnvalnmean-hs---pkrlqclspaqrtlwcise
 an          qilm           kqdhd gvle  evh rkpfihvhpk
             pmr            l tt   s            e g  a
              kq                   r                  
© 1998-2020Legal notice