Dataset for protein classical BH3-containing proteins of organism Podarcis muralis

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A670IXL8_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Podarcis muralis GN=PMAIP1 (length=56 residues).
MPSQRLELQLPPAPASTTNDSEAVRECALQLRRMGDKWNLRQKILNLISKLFCPET
>gnl|bcl2dbpro|A0A670JUU6_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=274 residues).
MNSYIEVTLTSVGMDLFPGEMDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPL
THCCGPGTRHAKQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEV
QIARKLQCIADQFHRLHLQRICMKDLHFPLLSVKIKVRFPPRILSTCSAVGKKKGMVRFERALDPQREGTYTQANPTTGS
EGTLWRKRMLQTTDGGVLEQEVHPRKPTEHVIPK
>gnl|bcl2dbpro|A0A670JUU6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=220 residues).
MNSYIEVTLTSVGMDLFPGEMDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPL
THCCGPGTRHAKQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEV
QIARKLQCIADQFHRLHLQRHQQNRNQVWWQILLFLHNVALNMEANRHHAGRSFIHGHSA
>gnl|bcl2dbpro|A0A670JUU6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=247 residues).
MDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR
ICMKDLHFPLLSVKIKVRFPPRILSTCSAVGKKKGMVRFERALDPQREGTYTQLYPWPLSLKRDSAGRPKRLQCLSPAQR
TLWCISE
>gnl|bcl2dbpro|A0A670JUU6_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=193 residues).
MDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQILLFLHNVALNMEANRHHAGRR
>gnl|bcl2dbpro|A0A670JUU6_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=194 residues).
MDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR
LYPWPLSLKRDSAGRPKRLQCLSPAQRTLWCISE
>gnl|bcl2dbpro|A0A670JUY4_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Podarcis muralis GN=BAD (length=91 residues).
LEFNNIRKDWTLALGTFRARSRSAPPILWAAQRYGRELRRMSDEFHGELQKLPRPKSAGTATQMRRTLGWKEVLQSWWRR
NSPGNGPRSPP
>gnl|bcl2dbpro|A0A670KEZ9_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Podarcis muralis GN=BCL2L11 (length=195 residues).
MAKQSSDLTSECGREGGQLQPAERPAQHLRPGAPTSLQTVYQGNHSGERDTSSPSSPQGPLAPPSSPSPFATRSPLFIFV
RRSPLLSRSSSGYFSFDTDRSPAPMSCDKATQTPSPPCQAFSHYLSAMAYRWQSRSIPEDIRPEIWIARELQRIGDEFNA
SYSPRRGFLDYQAVNHQIIILRLLHYIVRLIWRMQ
© 1998-2020Legal notice