Dataset for protein classical BH3-containing proteins of organism Podarcis muralis

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670KEZ9_BCL2L11      MAKQSSDLTSECGREGGQLQPAERPAQHLRPGAPTSL----QTVYQGNHS
A0A670JUU6_BMF-01       ---MNSYIEVTLTSVGMDLFPGEMDSPDYLEEDFSNLDGLEDDVFHSEDC
A0A670JUU6_BMF-05       -----------------------MDSPDYLEEDFSNLDGLEDDVFHSEDC
A0A670JUU6_BMF-03       -----------------------MDSPDYLEEDFSNLDGLEDDVFHSEDC
A0A670JUU6_BMF-04       ---MNSYIEVTLTSVGMDLFPGEMDSPDYLEEDFSNLDGLEDDVFHSEDC
A0A670JUU6_BMF-02       -----------------------MDSPDYLEEDFSNLDGLEDDVFHSEDC
A0A670IXL8_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------------
                                                                          

A0A670KEZ9_BCL2L11      GERDTSSPSSPQGPLAPPSSPSPFATRSPLFIFVRRSPLLSRSSSGYFSF
A0A670JUU6_BMF-01       GLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAK-----
A0A670JUU6_BMF-05       GLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAK-----
A0A670JUU6_BMF-03       GLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAK-----
A0A670JUU6_BMF-04       GLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAK-----
A0A670JUU6_BMF-02       GLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAK-----
A0A670IXL8_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------------
                                                                          

A0A670KEZ9_BCL2L11      DTDRSPAPMSCDKATQTPSPPC-------------QAFSHYLSAMAY---
A0A670JUU6_BMF-01       QQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLS
A0A670JUU6_BMF-05       QQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLS
A0A670JUU6_BMF-03       QQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLS
A0A670JUU6_BMF-04       QQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLS
A0A670JUU6_BMF-02       QQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLS
A0A670IXL8_PMAIP1-      ----------MPSQRLELQLPPAPA-------------------------
A0A670JUY4_BAD-01       --------LEFNNIRKDWTLALGTF-------------------------
                                    .       .                             

A0A670KEZ9_BCL2L11      ---RWQSRSIPEDIRPEIWIARELQRIGDEFNASYSPRRGFLDYQAVNHQ
A0A670JUU6_BMF-01       PHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR------------
A0A670JUU6_BMF-05       PHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR------------
A0A670JUU6_BMF-03       PHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR------------
A0A670JUU6_BMF-04       PHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQRICMKDLHFPLLS
A0A670JUU6_BMF-02       PHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQRICMKDLHFPLLS
A0A670IXL8_PMAIP1-      ---STTNDSE-----AVRECALQLRRMGDKWNLRQKILNLISKLFCPET-
A0A670JUY4_BAD-01       ---RARSRSAPPILWAAQRYGRELRRMSDEFH------GELQKLPRPKSA
                                .      .    . :*. :.*:::                  

A0A670KEZ9_BCL2L11      IIILRLLHYIVRLI------------------------------------
A0A670JUU6_BMF-01       ------------------------------HQQNRNQVW-----------
A0A670JUU6_BMF-05       ------------------------------HQQNRNQVW-----------
A0A670JUU6_BMF-03       ------------------------------LYP-----------------
A0A670JUU6_BMF-04       VKIKVRFPPRILSTCSAVGKKKGMVRFERALDPQREGTYTQANPTTGSEG
A0A670JUU6_BMF-02       VKIKVRFPPRILSTCSAVGKKKGMVRFERALDPQREGTYTQLYP------
A0A670IXL8_PMAIP1-      --------------------------------------------------
A0A670JUY4_BAD-01       GTATQMRRTLGWKEVLQSWWRRNSPGNGPRSPP-----------------
                                                                          

A0A670KEZ9_BCL2L11      --WRMQ--------------------------------------
A0A670JUU6_BMF-01       --WQILLFLHNVALNMEANRHHAGRS-----------FIHGHSA
A0A670JUU6_BMF-05       --WQILLFLHNVALNMEANRHHAGRR------------------
A0A670JUU6_BMF-03       --WPLSL-----------KRDSAGRPKRLQCLSPAQRTLWCISE
A0A670JUU6_BMF-04       TLWRKRM-----------LQTTDGGVLE-QEVHPRKPTEHVIPK
A0A670JUU6_BMF-02       --WPLSL-----------KRDSAGRPKRLQCLSPAQRTLWCISE
A0A670IXL8_PMAIP1-      --------------------------------------------
A0A670JUY4_BAD-01       --------------------------------------------
                                                                    

© 1998-2020Legal notice