Dataset for protein Bmf of organism Podarcis muralis

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                    ************************************************************
--------------------MDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPL
mnsyievtltsvgmdlfpge                                                            
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
THCCGPGTRHAKQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEV
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************                                                            
QIARKLQCIADQFHRLHLQR------------------------------------------lqpqrnqvy---------
                    icmkdlhfpllsvkikvrfpprilstcsavgkkkgmvrferahdqn-egtwtqlypttgs
                                                               y - ----  an     
                                                                                

       250       260       270       280      
....:....|....:....|....:....|....:....|....:.
    *   :            .   *                    
----Wqlsl-----------nrhsaGrp---q---p---tlwcise
egtl pilmflhnvalnmeakqdhd gvkrl-cls-aqr--h----
     rkr            l tt   sle  evh rkpfi-vhpk
                           r            e g  a
© 1998-2020Legal notice