Dataset for protein Bmf of organism Podarcis muralis

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A670JUU6_BMF-04 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=274 residues).
MNSYIEVTLTSVGMDLFPGEMDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPL
THCCGPGTRHAKQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEV
QIARKLQCIADQFHRLHLQRICMKDLHFPLLSVKIKVRFPPRILSTCSAVGKKKGMVRFERALDPQREGTYTQANPTTGS
EGTLWRKRMLQTTDGGVLEQEVHPRKPTEHVIPK
>gnl|bcl2dbpro|A0A670JUU6_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=220 residues).
MNSYIEVTLTSVGMDLFPGEMDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPL
THCCGPGTRHAKQQDKATQTLNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEV
QIARKLQCIADQFHRLHLQRHQQNRNQVWWQILLFLHNVALNMEANRHHAGRSFIHGHSA
>gnl|bcl2dbpro|A0A670JUU6_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=247 residues).
MDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR
ICMKDLHFPLLSVKIKVRFPPRILSTCSAVGKKKGMVRFERALDPQREGTYTQLYPWPLSLKRDSAGRPKRLQCLSPAQR
TLWCISE
>gnl|bcl2dbpro|A0A670JUU6_BMF-05 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=193 residues).
MDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR
HQQNRNQVWWQILLFLHNVALNMEANRHHAGRR
>gnl|bcl2dbpro|A0A670JUU6_BMF-03 Bcl2 modifying factor protein OS=[Eukaryota] Podarcis muralis GN=BMF (length=194 residues).
MDSPDYLEEDFSNLDGLEDDVFHSEDCGLASQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPRESPQELRTEVQIARKLQCIADQFHRLHLQR
LYPWPLSLKRDSAGRPKRLQCLSPAQRTLWCISE
© 1998-2020Legal notice