Dataset for protein Bmf of organism Podarcis muralis

[Download (right click)] [Edit] [Sequences] [Repertoires]

5 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A670JUU6_BMF-01      MNSYIEVTLTSVGMDLFPGEMDSPDYLEEDFSNLDGLEDDVFHSEDCGLA
A0A670JUU6_BMF-05      --------------------MDSPDYLEEDFSNLDGLEDDVFHSEDCGLA
A0A670JUU6_BMF-03      --------------------MDSPDYLEEDFSNLDGLEDDVFHSEDCGLA
A0A670JUU6_BMF-04      MNSYIEVTLTSVGMDLFPGEMDSPDYLEEDFSNLDGLEDDVFHSEDCGLA
A0A670JUU6_BMF-02      --------------------MDSPDYLEEDFSNLDGLEDDVFHSEDCGLA
                                           ******************************

A0A670JUU6_BMF-01      SQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
A0A670JUU6_BMF-05      SQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
A0A670JUU6_BMF-03      SQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
A0A670JUU6_BMF-04      SQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
A0A670JUU6_BMF-02      SQPNEMTFPGIFTQSKSYNCLLGRFQLFPLTHCCGPGTRHAKQQDKATQT
                       **************************************************

A0A670JUU6_BMF-01      LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPR
A0A670JUU6_BMF-05      LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPR
A0A670JUU6_BMF-03      LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPR
A0A670JUU6_BMF-04      LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPR
A0A670JUU6_BMF-02      LNPSSSSQDVMLPCGVTEEPQRLFYGNAGFRLHVNPIGFSLSPHLREEPR
                       **************************************************

A0A670JUU6_BMF-01      ESPQELRTEVQIARKLQCIADQFHRLHLQR--------------------
A0A670JUU6_BMF-05      ESPQELRTEVQIARKLQCIADQFHRLHLQR--------------------
A0A670JUU6_BMF-03      ESPQELRTEVQIARKLQCIADQFHRLHLQR--------------------
A0A670JUU6_BMF-04      ESPQELRTEVQIARKLQCIADQFHRLHLQRICMKDLHFPLLSVKIKVRFP
A0A670JUU6_BMF-02      ESPQELRTEVQIARKLQCIADQFHRLHLQRICMKDLHFPLLSVKIKVRFP
                       ******************************                    

A0A670JUU6_BMF-01      ----------------------HQQNRNQVW-------------WQILLF
A0A670JUU6_BMF-05      ----------------------HQQNRNQVW-------------WQILLF
A0A670JUU6_BMF-03      ----------------------LYP-------------------WPLSL-
A0A670JUU6_BMF-04      PRILSTCSAVGKKKGMVRFERALDPQREGTYTQANPTTGSEGTLWRKRM-
A0A670JUU6_BMF-02      PRILSTCSAVGKKKGMVRFERALDPQREGTYTQLYP--------WPLSL-
                                                                   *   : 

A0A670JUU6_BMF-01      LHNVALNMEANRHHAGRS-----------FIHGHSA
A0A670JUU6_BMF-05      LHNVALNMEANRHHAGRR------------------
A0A670JUU6_BMF-03      ----------KRDSAGRPKRLQCLSPAQRTLWCISE
A0A670JUU6_BMF-04      ----------LQTTDGGVLE-QEVHPRKPTEHVIPK
A0A670JUU6_BMF-02      ----------KRDSAGRPKRLQCLSPAQRTLWCISE
                                  .   *                    

© 1998-2020Legal notice