Dataset for protein Bik of organism Piliocolobus tephrosceles

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*. .** **      * *                             :  :**. **                   *. .
Mp-fRPqSRiprsgcErLlpgrggegpgrggrggapgpirsragsravdtkLLrwLT-------------------Daas
 sgv  i  dil--m t -----------------------------lyeq  ep  mevlgvtdpeedldpmedf ple

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    ****************************************************************************
iaaaSDMLALQLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGS
cmed                                                                            

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**   :.*                                          :*  *:: *       ::* . .**     
RVsreqvLl-----------------------------------------aL--LlllAl-----llaLlsggLH-----
  rafrf tltgsaasggcqscssgrhsphhslssavsslstsawshrlls gf vms qtsawswvs wpes  ladri

       250       260       270       280       290       300 
....:....|....:....|....:....|....:....|....:....|....:....|.
                                                         : *.
---------------------------------------------------------llLk
lvsspgqrppeqpswqpgpilhcpppgqlialtcvhplpvshrlaaaglfghvlratfp s
© 1998-2023Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice