Dataset for protein Bik of organism Piliocolobus tephrosceles

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8C9HKG2_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BIK (length=171 residues).
MPFRPQSRIPRSGCERLLPGRGGEGPGRGGRGGAPGPIRSRAGSRAVDTKLLRWLTDAASIAAASDMLALQLACIGDEMD
VSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLALLLLLALLLA
LLSGGLHLLLK
>gnl|bcl2dbpro|A0A8C9HKG2_BIK-03 BCL2-interacting killer protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BIK (length=160 residues).
MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMEDFDPLECMEDSDMLALQLACIGDEMDVSLRAPRLAQL
SEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVSREQVLLALLLLLALLLALLSGGLHLLLK
>gnl|bcl2dbpro|A0A8C9HKG2_BIK-02 BCL2-interacting killer protein OS=[Eukaryota] Piliocolobus tephrosceles GN=BIK (length=281 residues).
MPFRPQSRIPRSGCERLLPGRGGEGPGRGGRGGAPGPIRSRAGSRAVDTKLLRWLTDAASIAAASDMLALQLACIGDEMD
VSLRAPRLAQLSEVAMHSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVRAFRFLTLTGSAASGGCQ
SCSSGRHSPHHSLSSAVSSLSTSAWSHRLLSLGFLVMSAQTSAWSWVSLWPESLHLADRILVSSPGQRPPEQPSWQPGPI
LHCPPPGQLIALTCVHPLPVSHRLAAAGLFGHVLRATFPLS
© 1998-2022Legal notice