Dataset for protein Bik of organism Piliocolobus tephrosceles

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9HKG2_BIK-03      MSGVRPISRDILMETLLYEQLLEPLTMEVLGVTDPEEDLDPMED------
A0A8C9HKG2_BIK-01      ----MPFRPQSRIPRSGCERLLPGRGGEGPGRGGRGGAPGPIRSRAGSRA
A0A8C9HKG2_BIK-02      ----MPFRPQSRIPRSGCERLLPGRGGEGPGRGGRGGAPGPIRSRAGSRA
                            *:  :  :     *.**     *  *  .     .*: .      

A0A8C9HKG2_BIK-03      ---------FDPLECMEDSDMLALQLACIGDEMDVSLRAPRLAQLSEVAM
A0A8C9HKG2_BIK-01      VDTKLLRWLTDAASIAAASDMLALQLACIGDEMDVSLRAPRLAQLSEVAM
A0A8C9HKG2_BIK-02      VDTKLLRWLTDAASIAAASDMLALQLACIGDEMDVSLRAPRLAQLSEVAM
                                 *. .    ********************************

A0A8C9HKG2_BIK-03      HSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRV----
A0A8C9HKG2_BIK-01      HSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRV----
A0A8C9HKG2_BIK-02      HSLGLAFIYDQTDDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSRVRAFR
                       **********************************************    

A0A8C9HKG2_BIK-03      ---------------------------------------SREQVLLALLL
A0A8C9HKG2_BIK-01      ---------------------------------------SREQVLLALLL
A0A8C9HKG2_BIK-02      FLTLTGSAASGGCQSCSSGRHSPHHSLSSAVSSLSTSAWSHRLLSLGFLV
                                                              *.  : *.:*:

A0A8C9HKG2_BIK-03      LLAL-----LLALLSGGLHLLLK---------------------------
A0A8C9HKG2_BIK-01      LLAL-----LLALLSGGLHLLLK---------------------------
A0A8C9HKG2_BIK-02      MSAQTSAWSWVSLWPESLHLADRILVSSPGQRPPEQPSWQPGPILHCPPP
                       : *       ::* . .***  .                           

A0A8C9HKG2_BIK-03      -----------------------------------
A0A8C9HKG2_BIK-01      -----------------------------------
A0A8C9HKG2_BIK-02      GQLIALTCVHPLPVSHRLAAAGLFGHVLRATFPLS
                                                          

© 1998-2022Legal notice