Dataset for protein classical BH3-containing proteins of organism Physeter macrocephalus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------makqpsdvssecdreggqlqtaerppqlrpgapislqterq---------------------------------
mfqipe-----------------------------------------gnpegegdrcpqgspqgplappaspgpfatrsp
  mc cplqsgrgppavaacsl rsplrssaa  taarlkgpskh  ta gll eagh qgqpassshhggt avd   r
      fehreqed  p   ga p g gdk          a gd                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                        *.                                      
-----------------------drspapmscdkstqtpsPpcqafnhylsamasmrqsqavpadmrpeiwiaqelrrig
lfifvrrssllsrsssgyfsfdtssysrttwsrrqssrra a-----------------------lwgrvry--------
h                      mphr grkraqgrpeee sps lpt wpwlpfrgrvrslapw-laarnlgrqf  ms
                       elgq a ed ea e                caaa  a a  n d  qec i      

       170       180       190       200       210  
....:....|....:....|....:....|....:....|....:....|..
                                                    
defnayyprr--l-----a---------------------------------
-------k--vf-nnhqa-gthpqmvilrllrhiirlvwrmqlgrggpapsq
 klhgsq-llnlqsrpkssegat  rqspswtrflqsw nrn          
    frf g leipklfr                                  
© 1998-2020Legal notice