Dataset for protein classical BH3-containing proteins of organism Physeter macrocephalus

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A2Y9EHU3_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Physeter macrocephalus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDKPPGPSKHRQTAPGLLGEAGHQQGQPASSSHHGGTGAVDTRSRHSSYSAGT
EDDEGTEEEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDEFHGSFKGLPRPKSAGTATQMRQSPSWTRFLQSWWNRNLG
RGGPAPSQ
>gnl|bcl2dbpro|A0A2Y9SD47_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Physeter macrocephalus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A2Y9T3Y6_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Physeter macrocephalus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
>gnl|bcl2dbpro|A0A2Y9T3Y6_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Physeter macrocephalus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
>gnl|bcl2dbpro|A0A2Y9T3Y6_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Physeter macrocephalus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A2Y9TJ73_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Physeter macrocephalus GN=PMAIP1 (length=54 residues).
MPGRRARKSAQQSPTRAPADPEVECAIQFRRIGDKLNFRQKLLNLISKLFRSGT
© 1998-2020Legal notice