Dataset for protein classical BH3-containing proteins of organism Physeter macrocephalus

[Download (right click)] [Edit] [Sequences] [Repertoires]

6 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A2Y9SD47_HRK-01       --MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGD------
A0A2Y9EHU3_BAD-01       MFQIPEFEQSEQEDSSPADRGLGPSPTGDKPP--------GPSKHRQTAP
A0A2Y9T3Y6_BCL2L11      ------MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQ---
A0A2Y9T3Y6_BCL2L11      ------MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQGNP
A0A2Y9T3Y6_BCL2L11      ------MAKQPSDVSSECDREGGQLQTAERPPQLRPGAPISLQTERQGNP
                                                                          

A0A2Y9TJ73_PMAIP1-      --------------------------------------------------
A0A2Y9SD47_HRK-01       --------------------------------------------------
A0A2Y9EHU3_BAD-01       GLLGEAGHQQGQPASSSHHGGTGAVDTRSRH-------------------
A0A2Y9T3Y6_BCL2L11      --------------------------------------------------
A0A2Y9T3Y6_BCL2L11      EGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFS
A0A2Y9T3Y6_BCL2L11      EGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFS
                                                                          

A0A2Y9TJ73_PMAIP1-      ---MPGRRARKSAQQSPTRAPA------------------------DPEV
A0A2Y9SD47_HRK-01       ---ELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAALAAWLLGRR
A0A2Y9EHU3_BAD-01       ---SSYSAGTEDDEGTEEEEPS-----------PFRGRSRSAPPNLWAAQ
A0A2Y9T3Y6_BCL2L11      ---DRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEI
A0A2Y9T3Y6_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEI
A0A2Y9T3Y6_BCL2L11      FDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEI
                                            *.                            

A0A2Y9TJ73_PMAIP1-      ECAIQFRRIGDKLNFRQKLLNLISKLFRSGT-------------------
A0A2Y9SD47_HRK-01       NL------------------------------------------------
A0A2Y9EHU3_BAD-01       RYGRELRRMSDEFHGSFKG---LPRPKSAGTATQMRQSPSWTRFLQSWWN
A0A2Y9T3Y6_BCL2L11      WIAQELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWR
A0A2Y9T3Y6_BCL2L11      WIAQELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWR
A0A2Y9T3Y6_BCL2L11      WIAQELRRIGDEFNAYYPRRLEQ---------------------------
                                                                          

A0A2Y9TJ73_PMAIP1-      ------------
A0A2Y9SD47_HRK-01       ------------
A0A2Y9EHU3_BAD-01       RNLGRGGPAPSQ
A0A2Y9T3Y6_BCL2L11      MQ----------
A0A2Y9T3Y6_BCL2L11      MQ----------
A0A2Y9T3Y6_BCL2L11      ------------
                                    

© 1998-2020Legal notice