Dataset for protein classical BH3-containing proteins of organism Phocoena sinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               .      .                                                         
------makqpsdvssecdreggqlqpaerpp-----qlrpgapislqterqgnpegegdr--------------cpqgs
mfqipe-----qe-qcp-elvrdvsptgdgefspsrlgtsvsvlllvalrl----------ggtgavqtrsrtss-----
      fersr--pm vepphl rgrdevcacgagkhrqqspsasgtsghqksqldssssh     lelfplhhcysp l
        qamepg   a  ge pf   p        p  rlg qaedcga algaeplq                ga t
          e  d       d la                     a af      clhh                e   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                         :      .               
pqgplappaspgpfatrs----p-----rr-----rsssgyfsfdtdrspapmscdkstqtpsppcqafnhylsamasmr
------------------rtap-lfifv--sslls---------------qt-wygtaryrrqsa--s-pgfwaglpl-e
rptsqtekltqtlyrgsp s   nvwaalgyprwpgrqrvrprgsvtgl -rnfrsr gsmlpl vs-wttapqw---sa
edeegedeel saspca      alt    ag el gpgsmlpcprleg r l lrp e h e  pp lar  psggtq-
 aa a  a e a  la                     m de h gfkde     a n     a     a       cag 
                                                                              a 

       170       180       190       200       210       220       230 
....:....|....:....|....:....|....:....|....:....|....:....|....:....|.
                                                                       
qsqavpadmrpeiwiaqelrrigdefna----r--------------------------------------
----------------------------yypr-vflnqhqaaeghpqmvilrllrhlirlvwrmqpgmgpr
apavrqwwlqwrrqwnrq q mapqpsql e  lqqqnqrqrrsrwwwqynlimhniplprgenrneae n
 vgelgeqhlgavnlgan a g  dlh      rhme   hnpnpvrvl   f gl a ngd ga      
    ga ee a  e   k      a         ee                                   
                                                                       
© 1998-2022Legal notice