Dataset for protein classical BH3-containing proteins of organism Phocoena sinus

[Download (right click)] [Edit] [Sequences] [Repertoires]

8 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A8C9E480_HRK-01       --------------MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAAR
A0A8C9BKQ1_BMF-01       ----------MEPPQCVEELEDDVFQPEDGEP-----GTQPGSLLSADLF
A0A8C9CVE1_BBC3-01      ------MARARQEGSSP-EPVEGLARDGPRPF-----PLSRLVPSAVSCG
A0A8C9DZ46_BAD-01       MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKHRQRVPGLLGEAGH
A0A8C9CBP3_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPP-----QLRPGAPISLQTE
A0A8C9CBP3_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPP-----QLRPGAPISLQTE
A0A8C9CBP3_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPP-----QLRPGAPISLQTE
A0A8C9CBP3_BCL2L11      ------MAKQPSDVSSECDREGGQLQPAERPP-----QLRPGAPISLQTE
                                       .      .                           

A0A8C9E480_HRK-01       LKALGDELHQR---------------------------------------
A0A8C9BKQ1_BMF-01       AQSQLDCPLSR-----LQLFPLTHCCGPGLRPTSQEDKATQTLSPASP--
A0A8C9CVE1_BBC3-01      L------------------------CEPGLPAAPAAPALLPAAYLCAP-T
A0A8C9DZ46_BAD-01       QQGQPASSSHHGGTGAVETRSRHSSYSAGTEDEEGTEEEEPSPFRGRSRS
A0A8C9CBP3_BCL2L11      RQGNPEGEGDR--------------CPQGSPQGPLAPPASPGPFATRS--
A0A8C9CBP3_BCL2L11      RQGNPEGEGDR--------------CPQGSPQGPLAPPASPGPFATRS--
A0A8C9CBP3_BCL2L11      RQGNPEGEGDR--------------CPQGSPQGPLAPPASPGPFATRS--
A0A8C9CBP3_BCL2L11      RQ------------------------------------------------
                                                                          

A0A8C9E480_HRK-01       -------------------------------TMWRRRARSRRAPAPSALP
A0A8C9BKQ1_BMF-01       ----------------SQGVMLPCGVTEEPQRLFYGNAGYRLPLP----A
A0A8C9CVE1_BBC3-01      APPAVTAALGAPRWPGGPRSRPRGPRLDGPQP-SLSPAEQHLESPVPSAP
A0A8C9DZ46_BAD-01       APPNLWAARRYGRELRRMSDEFHGSFKGLPRPNSAGTATQMRQSP--SWT
A0A8C9CBP3_BCL2L11      --PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A8C9CBP3_BCL2L11      --PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A8C9CBP3_BCL2L11      --PLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFN
A0A8C9CBP3_BCL2L11      --------------------------DRSPAPMSCDKSTQTPSPPCQAFN
                                                             :      .     

A0A8C9E480_HRK-01       TYWPWLCAAAQVAALAAWLLGRRNL-------------------------
A0A8C9BKQ1_BMF-01       GFPAGLPLGEQPAEGQWQHRAEVQIARKLQRIADQFH-----RLHMQQHQ
A0A8C9CVE1_BBC3-01      GALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQQR
A0A8C9DZ46_BAD-01       RFLQS------------------WWNRNLARGGPAPSQ------------
A0A8C9CBP3_BCL2L11      HYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNHQ
A0A8C9CBP3_BCL2L11      HYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRLEQ----
A0A8C9CBP3_BCL2L11      HYLSAMGLSE----------------------------------------
A0A8C9CBP3_BCL2L11      HYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNHQ
                                                                          

A0A8C9E480_HRK-01       -------------------------------
A0A8C9BKQ1_BMF-01       QNRNRVWWQILLFLHNLALNGDENRNGAGPR
A0A8C9CVE1_BBC3-01      HRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
A0A8C9DZ46_BAD-01       -------------------------------
A0A8C9CBP3_BCL2L11      AAEGHPQMVILRLLRHIIRLVWRMQ------
A0A8C9CBP3_BCL2L11      -------------------------------
A0A8C9CBP3_BCL2L11      -------------------------------
A0A8C9CBP3_BCL2L11      AAEGHPQMVILRLLRHIIRLVWRMQ------
                                                       

© 1998-2022Legal notice