Dataset for protein classical BH3-containing proteins of organism Phocoena sinus

[Download (right click)] [Alignment] [Repertoires]

8 sequence(s)

>gnl|bcl2dbpro|A0A8C9BKQ1_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Phocoena sinus GN=BMF (length=184 residues).
MEPPQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPAGFPAGLPLGEQPAEGQWQHRAEVQIARKLQRIADQFHRLHMQQHQQNRNRVW
WQILLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A8C9CBP3_BCL2L11-02 BCL2-like 11 protein OS=[Eukaryota] Phocoena sinus GN=BCL2L11 (length=196 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
>gnl|bcl2dbpro|A0A8C9CBP3_BCL2L11-04 BCL2-like 11 protein OS=[Eukaryota] Phocoena sinus GN=BCL2L11 (length=167 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAY
YPRRLEQ
>gnl|bcl2dbpro|A0A8C9CBP3_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Phocoena sinus GN=BCL2L11 (length=131 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQGNPEGEGDRCPQGSPQGPLAPPASPGPFATRSPLFIFVR
RSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGLSE
>gnl|bcl2dbpro|A0A8C9CBP3_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Phocoena sinus GN=BCL2L11 (length=140 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPISLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNHQAAEGHPQMVILRLLRHIIRLVWRMQ
>gnl|bcl2dbpro|A0A8C9CVE1_BBC3-01 BCL2 binding component 3 protein OS=[Eukaryota] Phocoena sinus GN=BBC3 (length=193 residues).
MARARQEGSSPEPVEGLARDGPRPFPLSRLVPSAVSCGLCEPGLPAAPAAPALLPAAYLCAPTAPPAVTAALGAPRWPGG
PRSRPRGPRLDGPQPSLSPAEQHLESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEEQ
QRHRPSPWRVLYNLIMGLLPLPRGRGAPEMEPN
>gnl|bcl2dbpro|A0A8C9DZ46_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Phocoena sinus GN=BAD (length=168 residues).
MFQIPEFEQSEQEDSSPADRGLGPSPTGDRPPGPSKHRQRVPGLLGEAGHQQGQPASSSHHGGTGAVETRSRHSSYSAGT
EDEEGTEEEEPSPFRGRSRSAPPNLWAARRYGRELRRMSDEFHGSFKGLPRPNSAGTATQMRQSPSWTRFLQSWWNRNLA
RGGPAPSQ
>gnl|bcl2dbpro|A0A8C9E480_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Phocoena sinus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPSALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2022Legal notice