Dataset for protein Bmf of organism Phasianus colchicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRQPEQQDKATQT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
                                                                                

       170       180       190     
....:....|....:....|....:....|....:
     .  *   :  :.*:: . .:: . *  ** 
vqqnrrqvWwqsy--vvLqntgsrvqls-NrtGQr
hgcflngr gilfprlf hklalnleanr gl  p
© 1998-2020Legal notice