Dataset for protein Bmf of organism Phasianus colchicus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A669PL85_BMF-02      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
A0A669PL85_BMF-01      MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSC
                       **************************************************

A0A669PL85_BMF-02      LLGRFQLFPLTHCCGPGVRQPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
A0A669PL85_BMF-01      LLGRFQLFPLTHCCGPGVRQPEQQDKATQTLSPSSSSQDVMLPCGVTEEP
                       **************************************************

A0A669PL85_BMF-02      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
A0A669PL85_BMF-01      RRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIA
                       **************************************************

A0A669PL85_BMF-02      DQFHRLHIQRVGCFLRGRWGISYPRVVLQKTGSRLQLS-NGLGQP
A0A669PL85_BMF-01      DQFHRLHIQRHQQNRNQVWWQLF--LFLHNLALNVEANRNRTGQR
                       **********     .  *   :  :.*:: . .:: . *  ** 

© 1998-2020Legal notice