Dataset for protein Bmf of organism Phasianus colchicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A669PL85_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Phasianus colchicus GN=BMF (length=194 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRQPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
VGCFLRGRWGISYPRVVLQKTGSRLQLSNGLGQP
>gnl|bcl2dbpro|A0A669PL85_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Phasianus colchicus GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRQPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPNLQEEPQEGQREARTEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNRTGQR
© 1998-2020Legal notice